[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : ABE00484.1
DDBJ      :             Transcriptional regulator, MarR family
Swiss-Prot:             

Homologs  Archaea  15/68 : Bacteria  438/915 : Eukaryota  5/199 : Viruses  0/175   --->[See Alignment]
a.4.5
:118 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   10->103 2hztA PDBj 6e-27 69.3 %
:RPS:PDB   10->87 2d1hB PDBj 2e-09 10.4 %
:RPS:SCOP  9->103 1z7uA1  a.4.5.69 * 1e-32 36.8 %
:HMM:SCOP  1->102 2fswA1 a.4.5.69 * 3.6e-30 44.1 %
:RPS:PFM   17->106 PF01638 * HxlR 8e-25 56.7 %
:HMM:PFM   16->103 PF01638 * HxlR 1.5e-38 55.7 88/91  
:BLT:SWISS 1->103 YTCD_BACSU 5e-39 69.9 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE00484.1 GT:GENE ABE00484.1 GT:PRODUCT Transcriptional regulator, MarR family GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION 1764691..1765047 GB:FROM 1764691 GB:TO 1765047 GB:DIRECTION + GB:PRODUCT Transcriptional regulator, MarR family GB:NOTE COG0640 [K] Predicted transcriptional regulators GB:PROTEIN_ID ABE00484.1 GB:DB_XREF GI:90821845 LENGTH 118 SQ:AASEQ MTKKIYNIGVEATMDVIGGKWKPIILCNLRHQSLRTSELKRLIPNISQKMLTQQLRELEAADIINRKVYNQVPPKVEYSLSDYGQSLSTVLSDLCTWGEMHVDMLKKRGEDVELVNYD GT:EXON 1|1-118:0| BL:SWS:NREP 1 BL:SWS:REP 1->103|YTCD_BACSU|5e-39|69.9|103/126| BL:PDB:NREP 1 BL:PDB:REP 10->103|2hztA|6e-27|69.3|88/91| RP:PDB:NREP 1 RP:PDB:REP 10->87|2d1hB|2e-09|10.4|77/96| RP:PFM:NREP 1 RP:PFM:REP 17->106|PF01638|8e-25|56.7|90/91|HxlR| HM:PFM:NREP 1 HM:PFM:REP 16->103|PF01638|1.5e-38|55.7|88/91|HxlR| RP:SCP:NREP 1 RP:SCP:REP 9->103|1z7uA1|1e-32|36.8|95/108|a.4.5.69| HM:SCP:REP 1->102|2fswA1|3.6e-30|44.1|102/0|a.4.5.69|1/1|"Winged helix" DNA-binding domain| OP:NHOMO 1099 OP:NHOMOORG 458 OP:PATTERN ------------------------211211----1----1---48--1--221--------1------ 2---8--2112---1----------4-------1114343-63923-1----31---2--211-5-6855--111-11--231-1-1-1211-12----1-A---a5B-2----------------------------------114-1222---111-----11-11221-------------------121799999A5936B978A458878819--15364322222BI1------1--11---2---32-4-11--1--542211322-2-243---1----12------------1111-1111111-11---11111--8H2223222141-7111-2131----1---341------1---2-321-1-33------42433--13212-----------3-23132225171-7554541564234241--311--1-1211111111-323---2-----------------------------2-1112-----234152-22221131222222212--2-----31-1--1--11--2---1-2----------1-1-111-1111-31111-11---11111---21-13-11-2121-1-1--------2---111--2--1----------1-------------------------2136-3-1111111111-111111111111111111112164--11111--1---11111111111111--211111111111---------1111--412---211-----1--155455-2---------1113--------1-------------1-----1----31131321111111---2----------------1----1-------------------------------12 --------------------------------------------------------------------------------------------------------------------------------------------------------------1----1------3--------------1--1---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 118 STR:RPRED 100.0 SQ:SECSTR ccccEEEEcHHHHHHTccHHHHHHHHHHHHTccccHHHHHHHHHTccHHHHHHHHHHHHHTTcEEEEEcccEEEEEcTTHHHHHHHHHHHHHHHHHHHHHHHHTTccHHHHHHHHEEc DISOP:02AL 1-3,112-112,114-114,118-119| PSIPRED cccccccccHHHHHHHHccHHHHHHHHHHHcccccHHHHHHHcccccHHHHHHHHHHHHHcccEEEEEccccccEEEEEEcHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHcccc //