[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : ABE00485.1
DDBJ      :             Hypothetical membrane spanning protein
Swiss-Prot:             

Homologs  Archaea  11/68 : Bacteria  287/915 : Eukaryota  30/199 : Viruses  0/175   --->[See Alignment]
c.47.1
:254 amino acids
:PSIPRED
:DISOPRED
:RPS:SCOP  111->213 1z6mA1  c.47.1.13 * 3e-04 17.5 %
:RPS:PFM   24->245 PF03649 * UPF0014 8e-46 45.5 %
:HMM:PFM   9->246 PF03649 * UPF0014 1.9e-82 42.0 238/250  
:BLT:SWISS 25->251 YBBM_ECOLI 1e-71 58.6 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE00485.1 GT:GENE ABE00485.1 GT:PRODUCT Hypothetical membrane spanning protein GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION complement(1765136..1765900) GB:FROM 1765136 GB:TO 1765900 GB:DIRECTION - GB:PRODUCT Hypothetical membrane spanning protein GB:NOTE COG0390 [R] ABC-type uncharacterized transport system, permease component GB:PROTEIN_ID ABE00485.1 GB:DB_XREF GI:90821846 LENGTH 254 SQ:AASEQ MSQLSVNNLSLALAFALVLVAVYISNREKLGLTKDIFYSISRAIVQLVIVGYILKYIFNVNNVILTAAMSFFIVLNAAYNAHKRNPNGHKSYFNSLLAIFVSTYVTMGVLVASGSIRFIPSQIVPISGMIASNSMVAIGLCYRNLNTLFKNQRQQVLEKLALGASMKQASLPLLHASIKTAMQPTIDSAKTVGLVSLPGMMSGLIFAGVDPVRAIKYQIMVTFMLLSATSLGSIIAGYRTYKDYYNEKLQLRIK GT:EXON 1|1-254:0| BL:SWS:NREP 1 BL:SWS:REP 25->251|YBBM_ECOLI|1e-71|58.6|227/259| TM:NTM 4 TM:REGION 4->25| TM:REGION 48->70| TM:REGION 93->115| TM:REGION 217->238| SEG 4->22|lsvnnlslalafalvlvav| RP:PFM:NREP 1 RP:PFM:REP 24->245|PF03649|8e-46|45.5|222/246|UPF0014| HM:PFM:NREP 1 HM:PFM:REP 9->246|PF03649|1.9e-82|42.0|238/250|UPF0014| RP:SCP:NREP 1 RP:SCP:REP 111->213|1z6mA1|3e-04|17.5|103/172|c.47.1.13| OP:NHOMO 343 OP:NHOMOORG 328 OP:PATTERN -----------------------------------11111111------1-11--------------- -1-------------1111-1---1-111111-----111-------------1-1---------------1111111-----1-1111111----------------1----------------11-111111-1----------2111111----------11--1111-------------1------1-111111111-111111-----1111---1111------1111111111111111111111111111111-111--1111-11----1111---------------------------------111---1-1--1------------------1---1----1---1--1111111------------------1------------------------1--2-----------------------------------------111----------------------------------------1----111111111111111111111111------111-------------1-----------------1--11--111--1111---11---11-----------------------------11--11----1-1---1-------1----1-11-11---1111------1---1-1111-111111-1111111111111111111111----1111111111111111111111111-----------------1---------1-1------------------------------------1------------------11111-----11111----------------1---------------------------------------------1--1-111--- ------------111--------------------------------------------------------------------------111-1121111---324--2------------------------------------------------------------------1-1-----121112-1212----1 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4,6-6| PSIPRED cccccHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHccc //