[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : ABE00486.1
DDBJ      :             ABC transporter, ATP-binding protein
Swiss-Prot:             

Homologs  Archaea  68/68 : Bacteria  908/915 : Eukaryota  197/199 : Viruses  1/175   --->[See Alignment]
c.37.1
:217 amino acids
:PSIPRED
:DISOPRED
:BLT:PDB   3->210 1mv5D PDBj 2e-25 33.0 %
:RPS:PDB   3->210 3b5jA PDBj 1e-32 30.0 %
:RPS:SCOP  3->210 1b0uA  c.37.1.12 * 3e-30 26.4 %
:HMM:SCOP  6->210 1ii8.1 c.37.1.12 * 6e-57 34.3 %
:RPS:PFM   58->161 PF00005 * ABC_tran 1e-12 46.9 %
:HMM:PFM   43->161 PF00005 * ABC_tran 1.2e-24 41.2 114/118  
:HMM:PFM   8->60 PF03193 * DUF258 3.7e-07 26.9 52/161  
:BLT:SWISS 3->206 YBBL_ECOLI 1e-44 43.6 %
:PROS 134->148|PS00211|ABC_TRANSPORTER_1
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE00486.1 GT:GENE ABE00486.1 GT:PRODUCT ABC transporter, ATP-binding protein GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION complement(1765881..1766534) GB:FROM 1765881 GB:TO 1766534 GB:DIRECTION - GB:PRODUCT ABC transporter, ATP-binding protein GB:NOTE COG1101 [R] ABC-type uncharacterized transport system, ATPase component GB:PROTEIN_ID ABE00486.1 GB:DB_XREF GI:90821847 LENGTH 217 SQ:AASEQ MAILSLQNVGYKVDTNEILKNINLDINENEFITITGPSGGGKSTLLKIIATLLTATTGEIFFDGKNQDEYAITEYRQQVSYCFQQPSLFGETVFDNLSFPYEIRQKEFDEKSAIEALKSVNLPETYLHKDINSLSGGERQRVALLRNTMFLPKVLLLDEVTVGLDARSIEIVHEFIDKIWKQGVTILQITHHEGEIKQANKIIWVEEGMIKDVTTKR GT:EXON 1|1-217:0| BL:SWS:NREP 1 BL:SWS:REP 3->206|YBBL_ECOLI|1e-44|43.6|204/225| PROS 134->148|PS00211|ABC_TRANSPORTER_1|PDOC00185| SEG 44->57|tllkiiatlltatt| BL:PDB:NREP 1 BL:PDB:REP 3->210|1mv5D|2e-25|33.0|206/241| RP:PDB:NREP 1 RP:PDB:REP 3->210|3b5jA|1e-32|30.0|207/243| RP:PFM:NREP 1 RP:PFM:REP 58->161|PF00005|1e-12|46.9|98/123|ABC_tran| HM:PFM:NREP 2 HM:PFM:REP 43->161|PF00005|1.2e-24|41.2|114/118|ABC_tran| HM:PFM:REP 8->60|PF03193|3.7e-07|26.9|52/161|DUF258| GO:PFM:NREP 2 GO:PFM GO:0005524|"GO:ATP binding"|PF00005|IPR003439| GO:PFM GO:0016887|"GO:ATPase activity"|PF00005|IPR003439| RP:SCP:NREP 1 RP:SCP:REP 3->210|1b0uA|3e-30|26.4|208/258|c.37.1.12| HM:SCP:REP 6->210|1ii8.1|6e-57|34.3|204/370|c.37.1.12|1/1|P-loop containing nucleoside triphosphate hydrolases| OP:NHOMO 31941 OP:NHOMOORG 1174 OP:PATTERN DDB5GA67LJIGKHKEV6CA899NTABLO9LCE9DBBCDCEABJKHIaEMxiU7GOHKMGHG88I126 IKV5oIIGUUTEEDDCCEE-EG44HfEEEEEAOKKKQgdi9IFWKJMDODABWTTFBP77JKHDPKMaZgNQMLLfTSSImUHCABADSTMI5HBDH--EEPIIGUFUEM66666666887777ENKDMSMKOMSNLSTWX766eEgYffZaZKOMMGBCBG7RROSvvySEHCIAFDGFJCCDFEFGaQAHXj********s*******sttpt***WWe*wYcqssoop**YfgeeeaZbcfffbaSbXUUsbSVloVObSnkjOOnpaQMRcecceggjnlgqppprqoojkprloqXYXWWYZYYYYWWuhhZYahgjgg*m*********X*ci***Uefc*jcmugbdKB**icOTXZNOdYffEVXHJLJEEDGGEEGKE*y*JIThabfSeheghbheac*-NNaLLaLTu*K8*************aB99YhvdadgnfdFEFFFFFFOBF9HHIT55555555556798AB88A9788897494G99C6BXsmZbgmomokaWVWRiiv*bXZZMamg*ZacU4ETVRdLJOOaZslw*MUQENEFVDEFDEGDENLGJKLWWxDTOWQJOeGGPCPQPLLOTMJDDJESQPgMJHMGGFGGHC89999AB99EODDFFEWTYIXMSBLJiKNMONIOPNLMKMMPQMOR5-ACEBD331222lc*nIlZbgfecfdeZc-facbbadcbdgfaXYaYYas*xz*XcWZfXYaaabaaaZaZYaoWWVYZYaD4jkmmpmljlopo34GEACAABKKNKFChRsQPOOONEJKHGNHIPJLNMLDPDINOPWVXWVsnsZZeTaPljmEEFDFEFEEDRZYnXXYYXligkmGIHGFHGEFGBBAB57ENMMFFHJ66564665*7UC88BB-7878BA9HHDA6F899556TZjRRZpXfW8KB 3333VV9-D532IMIC8GCEINEUIQEAAACACIHF9HDEDEECB9FCFQKHTJDCDAACBDEAC688259598A9827888757946-HO88BDEA97BA59JKB3CPYnJRLTNZEA7ACNCXS8j8**Y1ZNaCCB7TBFZIADF97OA8nCNHMWFZ*DgMMBeNU*dUaU9A94v46389VXbtEdc7EdRWZ8 ------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------ DISOP:02AL 214-218| PSIPRED ccEEEEEEEEEEEccEEEEEccEEEEccccEEEEEccccccHHHHHHHHHHHHcccccEEEEccEEcccccHHHHHHHcEEEccccccccccHHHHHHcccccccHHHHHHHHHHHHHHcccHHHHHcccccccccHHHHHHHHHHHHHccccEEEEEcccccccHHHHHHHHHHHHHHHHcccEEEEEEccHHHHHHccEEEEEEccEEEEEcccc //