[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : ABE00508.1
DDBJ      :             Conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  55/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
b.6.1
:124 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   24->119 2dv6A PDBj 9e-05 13.5 %
:RPS:SCOP  26->124 1aacA  b.6.1.1 * 6e-08 14.1 %
:HMM:SCOP  15->123 1ibyA_ b.6.1.4 * 3.2e-16 22.6 %
:HMM:PFM   4->70 PF03748 * FliL 3.2e-05 23.0 61/149  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE00508.1 GT:GENE ABE00508.1 GT:PRODUCT Conserved hypothetical protein GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION complement(1787611..1787985) GB:FROM 1787611 GB:TO 1787985 GB:DIRECTION - GB:PRODUCT Conserved hypothetical protein GB:NOTE COG0718 [S] Uncharacterized protein conserved in bacteria GB:PROTEIN_ID ABE00508.1 GB:DB_XREF GI:90821869 LENGTH 124 SQ:AASEQ MITKIIVLVIGIALIGFISWWFFGKHEKEAVTADVADNVQEVTVKVDGGYSPETVVLKKGVPAVINFYRKDPSSCLEQVVFSDFGISKMLPENENTKIEINTDKAGEYGFACGMNMFHGKVIIK GT:EXON 1|1-124:0| TM:NTM 1 TM:REGION 2->24| SEG 5->18|iivlvigialigfi| RP:PDB:NREP 1 RP:PDB:REP 24->119|2dv6A|9e-05|13.5|96/422| HM:PFM:NREP 1 HM:PFM:REP 4->70|PF03748|3.2e-05|23.0|61/149|FliL| RP:SCP:NREP 1 RP:SCP:REP 26->124|1aacA|6e-08|14.1|99/105|b.6.1.1| HM:SCP:REP 15->123|1ibyA_|3.2e-16|22.6|106/0|b.6.1.4|1/1|Cupredoxins| OP:NHOMO 78 OP:NHOMOORG 55 OP:PATTERN -------------------------------------------------------------------- ------------------------1-------------------------------------1--------1111111---------------------------------------------------------------------111-----11-----------2-------------------------------------------------------------------------------------211--122221-22---2--------------2--12222222222-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------221211--------------------------------1---1111------1-1-------------------------------------------------------------------------------------------------------------1----------11----------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 96 STR:RPRED 77.4 SQ:SECSTR #######################ccEEEEEEEEEETTEEEEEEEGGGTTcccccEEEETTcEEEEEEEcccccccccEETTTTEEccccccTTcEEEEEEEccccEEEEEEcTTHHHHT##### DISOP:02AL 1-1,29-36| PSIPRED cccEEEHHHHHHHHHHHHHHHEEccccccccEEEEcccEEEEEEEEcccccccEEEEEcccEEEEEEEcccccccccEEEEccccccccccccccEEEEEcccccccEEEEEEEcEEEEEEEEc //