[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : ABE00521.1
DDBJ      :             Conserved hypothetical protein
Swiss-Prot:Y1719_LACS1  RecName: Full=UPF0246 protein LSL_1719;

Homologs  Archaea  0/68 : Bacteria  379/915 : Eukaryota  14/199 : Viruses  0/175   --->[See Alignment]
:247 amino acids
:PSIPRED
:RPS:PFM   1->237 PF03883 * DUF328 1e-41 40.4 %
:HMM:PFM   1->236 PF03883 * DUF328 7.7e-80 42.1 233/237  
:BLT:SWISS 1->247 Y1719_LACS1 e-143 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE00521.1 GT:GENE ABE00521.1 GT:PRODUCT Conserved hypothetical protein GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION complement(1801589..1802332) GB:FROM 1801589 GB:TO 1802332 GB:DIRECTION - GB:PRODUCT Conserved hypothetical protein GB:NOTE COG0718 [S] Uncharacterized protein conserved in bacteria GB:PROTEIN_ID ABE00521.1 GB:DB_XREF GI:90821882 LENGTH 247 SQ:AASEQ MKIIISPAKKMVEDTDSFDISKLPIFKDKAEVLLTWLKSKNYDELKNIWKCNDKIAKLNYDRVQDMNLDENLTPAVMAYSGIQYQAMGPQVFTQEALQRAAKDLYIISGFYGILGAMDGITPYRLEMQAKVDINDQHTLYQFWGDSIYQELYRDNELVVNLASKEYSKAIERYLKPQDKFIICSFKKEKNGKYVQQATAAKQARGDMVRYILENNIKEIDEIKNFSVNGYQYEPQFSTDTELVFIKN GT:EXON 1|1-247:0| SW:ID Y1719_LACS1 SW:DE RecName: Full=UPF0246 protein LSL_1719; SW:GN OrderedLocusNames=LSL_1719; SW:KW Complete proteome. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->247|Y1719_LACS1|e-143|100.0|247/247| RP:PFM:NREP 1 RP:PFM:REP 1->237|PF03883|1e-41|40.4|235/239|DUF328| HM:PFM:NREP 1 HM:PFM:REP 1->236|PF03883|7.7e-80|42.1|233/237|DUF328| OP:NHOMO 396 OP:NHOMOORG 393 OP:PATTERN -------------------------------------------------------------------- ----------1-----------------------------------------1-------11------------------11------1111-111---111111-----------------------------------------11----------------------------------------------------------------------------------------------------------1111111111111111-11------11111111111111111111111111111111111111111111----1-------1-1-1---1111--11-11--11-------------11---1111--------------------------------------------------------1-111-1111111----------------------------1-11-11-1-11--------1--111111111111-111111111111111111111111111111111111111----111111111---111--1-1-----1------------------------------------------------111111111111111111111111111111-------------11111111111111111-1111111111111111111111111111111111111111111111111111-111111111111--1------1111-1111111111-1111111111111111111111111111111111111111111111111111111111111----------------1----------------------------------1-1------------------- ------1-----------------------------------------------------------------------------------------------------2----------------------------------------------------------------2----12111---------111111- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PSIPRED cEEEEccHHHccccccccccccccccHHHHHHHHHHHHHccHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHcHHHHHcccHHHccHHHHHHHHHccEEHHHHHHHcccccccccEEEEccccccccccccHHHHHHHHHHHHHHHcccEEEEccHHHHHHHHcccccccccEEEEEEEEccccEEEEEEEccHHHHHHHHHHHHHcccccHHHHHccccccEEEcHHHcccccEEEEcc //