[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : ABE00522.1
DDBJ      :             Hypothetical membrane spanning protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  7/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:244 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   101->200 PF02517 * Abi 7e-05 36.0 %
:HMM:PFM   102->205 PF02517 * Abi 3.9e-19 28.4 95/99  
:BLT:SWISS 97->200 YPBD_BACSU 4e-04 33.7 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE00522.1 GT:GENE ABE00522.1 GT:PRODUCT Hypothetical membrane spanning protein GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION complement(1802359..1803093) GB:FROM 1802359 GB:TO 1803093 GB:DIRECTION - GB:PRODUCT Hypothetical membrane spanning protein GB:PROTEIN_ID ABE00522.1 GB:DB_XREF GI:90821883 LENGTH 244 SQ:AASEQ MEKKTFIIPVGLVGLYAVLLVISGIIVQLLSLNSSNSKTFASVIINFVICTLFLWLNKKYIRVKIDFKFTFSFFKRHIILATVLAIITILIVIGNVKNLPLALMVSLQAGIVEEVICRGIISKYIYNDLNKVEEKRRIWISAISSGLAFGMLHFINLFRQGLLPTINQVIAATAIGMFLGVIYLVYKNLFGTIFIHFLNDFWIIAVTGTITEQDSGTIAMIISSVLYWIILGFIAWRIIKKKVA GT:EXON 1|1-244:0| BL:SWS:NREP 1 BL:SWS:REP 97->200|YPBD_BACSU|4e-04|33.7|83/100| TM:NTM 8 TM:REGION 6->28| TM:REGION 37->57| TM:REGION 77->99| TM:REGION 102->124| TM:REGION 138->160| TM:REGION 164->186| TM:REGION 191->213| TM:REGION 216->238| SEG 10->21|vglvglyavllv| SEG 78->93|iilatvlaiitilivi| RP:PFM:NREP 1 RP:PFM:REP 101->200|PF02517|7e-05|36.0|89/97|Abi| HM:PFM:NREP 1 HM:PFM:REP 102->205|PF02517|3.9e-19|28.4|95/99|Abi| GO:PFM:NREP 1 GO:PFM GO:0016020|"GO:membrane"|PF02517|IPR003675| OP:NHOMO 9 OP:NHOMOORG 7 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------2------1--1---2--1-----------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3,244-245| PSIPRED ccccEEEEEHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHcccEEEEEEEEEEEHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHcc //