[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : ABE00525.1
DDBJ      :             Hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:40 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   11->38 PF02885 * Glycos_trans_3N 0.00011 17.9 28/66  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE00525.1 GT:GENE ABE00525.1 GT:PRODUCT Hypothetical protein GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION complement(1804845..1804967) GB:FROM 1804845 GB:TO 1804967 GB:DIRECTION - GB:PRODUCT Hypothetical protein GB:PROTEIN_ID ABE00525.1 GB:DB_XREF GI:90821886 LENGTH 40 SQ:AASEQ MAMTEERLSSTQKIIQQVMNERKLSYKEAIAFLLEYTEKR GT:EXON 1|1-40:0| HM:PFM:NREP 1 HM:PFM:REP 11->38|PF02885|0.00011|17.9|28/66|Glycos_trans_3N| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-9,39-41| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc //