[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : ABE00531.1
DDBJ      :             Hypothetical secreted protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:255 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   53->155 PF11611 * TRF2 4.7e-06 21.6 88/123  
:HMM:PFM   7->98 PF11873 * DUF3393 0.00031 24.4 90/204  
:HMM:PFM   145->228 PF00339 * Arrestin_N 0.00098 14.3 77/149  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE00531.1 GT:GENE ABE00531.1 GT:PRODUCT Hypothetical secreted protein GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION 1811803..1812570 GB:FROM 1811803 GB:TO 1812570 GB:DIRECTION + GB:PRODUCT Hypothetical secreted protein GB:PROTEIN_ID ABE00531.1 GB:DB_XREF GI:90821892 LENGTH 255 SQ:AASEQ MKKRYVLIGLLSLLFLGACSNNKQETASSSSSHVSSSLASTDTINQTLDTVGSLKYHLGTVTTRKVENDRNNYTEAERKFKYKSSLGDTYYRTTITYSVTNVGEETINLAKTPLSVTTDDGSKFTSTGKLNHYAHNVLVNGYKLKVGKKLQGKLVLLSSHKLDISSIQLNIGTQVPYNSIDDTAEVTSENTTNSATTSSAVSSTTSSSDGISPDLQQQLIQNEQGENKVNGSNSGSSNSSASSSSAQTGTSETAQ GT:EXON 1|1-255:0| SEG 7->16|ligllsllfl| SEG 28->40|ssssshvssslas| SEG 143->157|klkvgkklqgklvll| SEG 185->208|evtsenttnsattssavssttsss| SEG 230->254|ngsnsgssnssassssaqtgtseta| HM:PFM:NREP 3 HM:PFM:REP 53->155|PF11611|4.7e-06|21.6|88/123|TRF2| HM:PFM:REP 7->98|PF11873|0.00031|24.4|90/204|DUF3393| HM:PFM:REP 145->228|PF00339|0.00098|14.3|77/149|Arrestin_N| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2,21-38,191-214,218-256| PSIPRED cccEEEEHHHHHHHHHHHcccccHHHcccccHHHHHHHccHHHHHHHHHHHccEEEEEEEEEEEEEcccccccHHHHHHHHHHcccccEEEEEEEEEEEEccccHHEEcccccEEEEEcccccEEcccccccEEEEEEEccEEEEEccccccEEEEEEccccEEEEEEEEEcccccccccccccEEccccccccccccHHccccccccccccHHHHHHHHHHHcccccccccccccccccccccccccccccccc //