[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : ABE00534.1
DDBJ      :             Hypothetical secreted protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  3/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:169 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   23->119 PF12316 * Dsh_C 5e-05 23.7 97/203  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE00534.1 GT:GENE ABE00534.1 GT:PRODUCT Hypothetical secreted protein GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION 1821043..1821552 GB:FROM 1821043 GB:TO 1821552 GB:DIRECTION + GB:PRODUCT Hypothetical secreted protein GB:PROTEIN_ID ABE00534.1 GB:DB_XREF GI:90821895 LENGTH 169 SQ:AASEQ MRKKLFLIPLFISLFLLGACSNNSTSQNSESSSNSSSVKTSKLVKSSSQKKSSSIKSSSSSSQSSSSSNEVASDSSNAIPSSSVSASSQSQDVTTDNNSVLTSFLNASGVQLGNGDIAFITGENNGMYEIEIRTQSPGSTAVTNLKGIYHYNPTTGSIQKMDPTTGVFN GT:EXON 1|1-169:0| TM:NTM 1 TM:REGION 5->23| SEG 5->17|lfliplfislfll| SEG 21->90|snnstsqnsesssnsssvktsklvksssqkksssikssssssqsssssnevasdssnaipsssvsassqs| HM:PFM:NREP 1 HM:PFM:REP 23->119|PF12316|5e-05|23.7|97/203|Dsh_C| OP:NHOMO 3 OP:NHOMOORG 3 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11---1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2,21-95,169-170| PSIPRED cccEEEEHHHHHHHHHHHccccccccccccccccccccHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccHHHHHHHccccEEEccccEEEEEcccccEEEEEEEEccccccEEEEccEEEEEccccccEEEccccccccc //