[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : ABE00535.1
DDBJ      :             Transcriptional Regulator, LysR substrate binding
Swiss-Prot:             

Homologs  Archaea  3/68 : Bacteria  613/915 : Eukaryota  6/199 : Viruses  0/175   --->[See Alignment]
a.4.5c.94.1
:292 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   5->273 3hhgG PDBj 8e-09 22.6 %
:RPS:PDB   1->197 1bi3A PDBj 3e-25 14.9 %
:RPS:PDB   217->269 2ekgB PDBj 7e-04 18.9 %
:RPS:SCOP  6->101 1fokA2  a.4.5.12 * 5e-17 13.5 %
:RPS:SCOP  86->292 1i69A  c.94.1.1 * 7e-18 18.8 %
:HMM:SCOP  1->89 1ixcA1 a.4.5.37 * 7e-18 38.2 %
:HMM:SCOP  85->294 2esnA2 c.94.1.1 * 8.1e-22 19.4 %
:RPS:PFM   5->62 PF00126 * HTH_1 1e-10 51.7 %
:RPS:PFM   131->275 PF03466 * LysR_substrate 8e-10 25.4 %
:HMM:PFM   4->62 PF00126 * HTH_1 8.3e-23 50.8 59/60  
:HMM:PFM   122->279 PF03466 * LysR_substrate 1.9e-22 23.2 155/209  
:BLT:SWISS 4->198 CMPR_SYNY3 6e-18 29.2 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE00535.1 GT:GENE ABE00535.1 GT:PRODUCT Transcriptional Regulator, LysR substrate binding GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION complement(1821643..1822521) GB:FROM 1821643 GB:TO 1822521 GB:DIRECTION - GB:PRODUCT Transcriptional Regulator, LysR substrate binding GB:NOTE COG0583 [K] Transcriptional regulator GB:PROTEIN_ID ABE00535.1 GB:DB_XREF GI:90821896 LENGTH 292 SQ:AASEQ MLDNKIETFMMVAHLKSYTKAAESLFISQPAVSQQIRQLEEEFGVKLFNYEKRKLFLTTEGKELLKFAESVKVQTKNIKIKMKLSDKQSSPLNFATTFSLSNNDAWKIVDYYRNQRSKKIVCQTFNTQQCLEALNNGKIDFALIEGNFKQDDYDKVIIRNEPFIAVGKRGLGIEANKEYDLRELINYPLIYREQGSGSLEITRQILGMRNLSPIDFKQEYQIGSLSLFRRMLLDGVGIGFCYQCLLTDELDDGIIQKIKIKNMEVAHPISLVWLKGNDQLKEEIQVVKEILK GT:EXON 1|1-292:0| BL:SWS:NREP 1 BL:SWS:REP 4->198|CMPR_SYNY3|6e-18|29.2|195/304| BL:PDB:NREP 1 BL:PDB:REP 5->273|3hhgG|8e-09|22.6|257/294| RP:PDB:NREP 2 RP:PDB:REP 1->197|1bi3A|3e-25|14.9|194/211| RP:PDB:REP 217->269|2ekgB|7e-04|18.9|53/298| RP:PFM:NREP 2 RP:PFM:REP 5->62|PF00126|1e-10|51.7|58/60|HTH_1| RP:PFM:REP 131->275|PF03466|8e-10|25.4|142/207|LysR_substrate| HM:PFM:NREP 2 HM:PFM:REP 4->62|PF00126|8.3e-23|50.8|59/60|HTH_1| HM:PFM:REP 122->279|PF03466|1.9e-22|23.2|155/209|LysR_substrate| GO:PFM:NREP 2 GO:PFM GO:0003700|"GO:transcription factor activity"|PF00126|IPR000847| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF00126|IPR000847| RP:SCP:NREP 2 RP:SCP:REP 6->101|1fokA2|5e-17|13.5|96/135|a.4.5.12| RP:SCP:REP 86->292|1i69A|7e-18|18.8|197/206|c.94.1.1| HM:SCP:REP 1->89|1ixcA1|7e-18|38.2|89/0|a.4.5.37|1/1|"Winged helix" DNA-binding domain| HM:SCP:REP 85->294|2esnA2|8.1e-22|19.4|206/0|c.94.1.1|1/1|Periplasmic binding protein-like II| OP:NHOMO 1881 OP:NHOMOORG 622 OP:PATTERN -------------------------------------1----1----------1-------------- 133-----------121---------------1----33--211--------------------1--11---11111111231211111111-2-------5-1-4-1-3---------------1---1----1-32212---112222334222211111123254441111111111111121-----3296666656715656764-76765591217231244333DJ1112222-2211122211221112-1212-24411111251123-1-------11111111111111-------------11----1111-5489666667626326553222931112242189421211622111-13-2-1---11--1--34322-3-42311211122121-1231231532-1533322343356123---12-1--121--------1-1---1--------------------------------12-126542A999A81333388783323238697A85-1664121228333624434-114-11111-111333211-111311-3112-2--5362212211-1121----1111-1---------131122222513121224-22221-456646224324---1222------54731456654643466-765674356574655565458633-267365777776757555444343442-322222222222---3-----32331334F---1---111122214444414232317787977736768413331111121152334555555567634-1-1111-1111--2-11------------1-------------------------------------211 -------------1------------------------------------------------------------------------------------------------------------------------------------------------3-----------5----1------------2-----1---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 279 STR:RPRED 95.5 SQ:SECSTR HHHHHHHHHHHHTccccHHHHHHHHTccHHHHHHHHHHHHHTTcEccEEcTTccEEEcHHHHHHHHHHHHHHHHHHHHHHHHTTcccHHHHHHHHHHTTTccHHHHHHHHHHcccccccTTccccTTHHHHTcccEEHHHHcccccEEEEEEEccGGGccccTHHHHHHHTTccTTcEEEEccccEEEETTEEEEccEEEccTTTGGGEEEcccGHEEEEEEccHHHHHHHHHHTccEEEEEGGGcHcTTTcTTcEEEEccTTcccEEEEEEEETTccc############# DISOP:02AL 80-89| PSIPRED ccHHHHHHHHHHHHHccHHHHHHHHccccHHHHHHHHHHHHHHccEEEEEccccEEEcHHHHHHHHHHHHHHHHHHHHHHHHHHcccccEEEEEEEEccHHHHHHHHHHHHHHHccccEEEEEEccHHHHHHHHHcccccEEEEccccccccEEEEEEEcccEEEEEcccccccccccccHHHHccccEEEccccccHHHHHHHHHHHccccccccEEEEEEccHHHHHHHHHccccEEEEEHHHHHHHHccccEEEEEccccccEEEEEEEEcccccccHHHHHHHHHHHc //