[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : ada
DDBJ      :ada          O6-methylguanine-DNA methyltransferase
Swiss-Prot:             

Homologs  Archaea  21/68 : Bacteria  699/915 : Eukaryota  61/199 : Viruses  1/175   --->[See Alignment]
a.4.2c.55.7
:153 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   6->152 1wrjA PDBj 2e-18 36.7 %
:RPS:PDB   1->152 1eh7A PDBj 3e-35 27.5 %
:RPS:SCOP  1->74 1eh6A2  c.55.7.1 * 3e-12 23.0 %
:RPS:SCOP  71->152 1eh6A1  a.4.2.1 * 1e-27 33.8 %
:HMM:SCOP  1->76 1qntA2 c.55.7.1 * 1.1e-11 30.7 %
:HMM:SCOP  70->155 1sfeA1 a.4.2.1 * 1.7e-24 50.0 %
:RPS:PFM   73->152 PF01035 * DNA_binding_1 3e-18 44.9 %
:HMM:PFM   71->153 PF01035 * DNA_binding_1 2.5e-26 49.4 81/85  
:BLT:SWISS 7->153 OGT_MYCLE 1e-24 43.4 %
:PROS 123->129|PS00374|MGMT

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABD99368.1 GT:GENE ada GT:PRODUCT O6-methylguanine-DNA methyltransferase GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION 599192..599653 GB:FROM 599192 GB:TO 599653 GB:DIRECTION + GB:GENE ada GB:PRODUCT O6-methylguanine-DNA methyltransferase GB:NOTE COG0350 [L] Methylated DNA-protein cysteine methyltransferase GB:PROTEIN_ID ABD99368.1 GB:DB_XREF GI:90820729 GB:GENE:GENE ada LENGTH 153 SQ:AASEQ MYKMNYDSPIGNIVLKSDGYSLVECYFSDEEENEEKNIGNVVLEETVQWLDDYFKGNKPLIKDLPIKFKGTEFQLKVWNELLKIPYGSTISYKELGKIIFGEKNISSQAIGRAVSKNKLLVIVPCHRVIGSRGDLVGYAGGIDRKKYLLDHEK GT:EXON 1|1-153:0| BL:SWS:NREP 1 BL:SWS:REP 7->153|OGT_MYCLE|1e-24|43.4|143/165| PROS 123->129|PS00374|MGMT|PDOC00320| BL:PDB:NREP 1 BL:PDB:REP 6->152|1wrjA|2e-18|36.7|139/150| RP:PDB:NREP 1 RP:PDB:REP 1->152|1eh7A|3e-35|27.5|149/161| RP:PFM:NREP 1 RP:PFM:REP 73->152|PF01035|3e-18|44.9|78/85|DNA_binding_1| HM:PFM:NREP 1 HM:PFM:REP 71->153|PF01035|2.5e-26|49.4|81/85|DNA_binding_1| GO:PFM:NREP 2 GO:PFM GO:0003824|"GO:catalytic activity"|PF01035|IPR014048| GO:PFM GO:0006281|"GO:DNA repair"|PF01035|IPR014048| RP:SCP:NREP 2 RP:SCP:REP 1->74|1eh6A2|3e-12|23.0|74/78|c.55.7.1| RP:SCP:REP 71->152|1eh6A1|1e-27|33.8|80/90|a.4.2.1| HM:SCP:REP 1->76|1qntA2|1.1e-11|30.7|75/0|c.55.7.1|1/1|Methylated DNA-protein cysteine methyltransferase domain| HM:SCP:REP 70->155|1sfeA1|1.7e-24|50.0|84/0|a.4.2.1|1/1|Methylated DNA-protein cysteine methyltransferase, C-terminal domain| OP:NHOMO 1111 OP:NHOMOORG 782 OP:PATTERN ------11111111111------1--------1--11------------1111-----1--------1 113-1---111--1-1111-1111121111112111-2211211121212212----1111111--222211111111-121------111111111--112111312-3--------------1--111---1--1111111-1-2--111----1---------1111----------------1111111222222222122222222222222211131223233323211111111111111111111111-11-12-1111111111---1-1111111111111111111111-------------1111--11111121111111121111211-11-21111---1-332--1111111111111113331-1111212111111111-11221222222-111111-1-31-222322122233111-11231-1212211111111222-1111------------1-11112---11------11111233233333332223233332122226233324--33312112-11111211-1123-11111111211112-1-1--1111----11--1-111121221-12111111111111111111121-11223211112-111122122112111-111111---21-1------22221312222222212-222222222222222222232334112222222222222222212222222--222222212222--11121112221-121211111111111111122212121111222312233222221111111111111-111211111-11111211111---1111--11111111--------111-------1----------1-1----1-11-11111-12 ----11--21---1-------------------------------------------------11-1--11111111111111111------------------------1----1-1--1-111--1-241-111-1-12-111-11--1----1-12----31--1--41-51----------1------1-1---- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---- STR:NPRED 153 STR:RPRED 100.0 SQ:SECSTR cEEEEEccTTccEEEEEETTEEEEEEEcccccccccccccHHHHHHHHHHHHHHHcGGGGGGccHHHHcccHHHHHHHHHHHHccTTccEEHHHHHHHTTTcTTTcHHHHHHHHTTccccTTTccGGEEcTTccccccTTcHHHHHHHHHHTH DISOP:02AL 153-154| PSIPRED ccccEEEcccEEEEEEEEccEEEEEEcccccHHHHHccccHHHHHHHHHHHHHHcccccccccccccccccHHHHHHHHHHHccccccEEcHHHHHHHcccccccHHHHHHHHHHHcccccccccEEEEccccccccccccHHHHHHHHHHcc //