[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : adk
DDBJ      :adk          Adenylate kinase / Nucleoside-diphosphate kinase
Swiss-Prot:             

Homologs  Archaea  25/68 : Bacteria  904/915 : Eukaryota  195/199 : Viruses  0/175   --->[See Alignment]
c.37.1
:219 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   3->218 3fb4A PDBj 1e-80 64.2 %
:RPS:PDB   3->219 3dl0A PDBj 5e-76 67.6 %
:RPS:SCOP  4->216 1knqA  c.37.1.17 * 6e-19 16.6 %
:HMM:SCOP  1->218 1dekA_ c.37.1.1 * 1.9e-44 32.7 %
:RPS:PFM   7->194 PF00406 * ADK 5e-39 57.2 %
:HMM:PFM   7->193 PF00406 * ADK 1.3e-58 54.0 150/151  
:BLT:SWISS 3->218 KAD_LACRJ 1e-99 76.4 %
:PROS 83->94|PS00113|ADENYLATE_KINASE

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE00218.1 GT:GENE adk GT:PRODUCT Adenylate kinase / Nucleoside-diphosphate kinase GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION complement(1485304..1485963) GB:FROM 1485304 GB:TO 1485963 GB:DIRECTION - GB:GENE adk GB:PRODUCT Adenylate kinase / Nucleoside-diphosphate kinase GB:NOTE COG0563 [F] Adenylate kinase and related kinases GB:PROTEIN_ID ABE00218.1 GB:DB_XREF GI:90821579 GB:GENE:GENE adk LENGTH 219 SQ:AASEQ MAMNLMLMGLPGAGKGTQAERIVDEYKIPHISTGDIFRAAMKNETPMGLEAKKYINKGELVPDEVTNGIVKERLTQDDTNVGFLLDGFPRNMAQAEALTEMGKELGKELNGVINIHVDPESLMERLTGRYICRNCGATYHKVFNPTKVEGTCDRCGEHEFYQRDDDKPETVKNRLDVNIKMNTPLLDYYKENGLLHEVDGNQDIDKVFADIKAILDNLK GT:EXON 1|1-219:0| BL:SWS:NREP 1 BL:SWS:REP 3->218|KAD_LACRJ|1e-99|76.4|216/217| PROS 83->94|PS00113|ADENYLATE_KINASE|PDOC00104| BL:PDB:NREP 1 BL:PDB:REP 3->218|3fb4A|1e-80|64.2|215/215| RP:PDB:NREP 1 RP:PDB:REP 3->219|3dl0A|5e-76|67.6|216/216| RP:PFM:NREP 1 RP:PFM:REP 7->194|PF00406|5e-39|57.2|159/159|ADK| HM:PFM:NREP 1 HM:PFM:REP 7->193|PF00406|1.3e-58|54.0|150/151|ADK| GO:PFM:NREP 3 GO:PFM GO:0005524|"GO:ATP binding"|PF00406|IPR000850| GO:PFM GO:0006139|"GO:nucleobase, nucleoside, nucleotide and nucleic acid metabolic process"|PF00406|IPR000850| GO:PFM GO:0019205|"GO:nucleobase, nucleoside, nucleotide kinase activity"|PF00406|IPR000850| RP:SCP:NREP 1 RP:SCP:REP 4->216|1knqA|6e-19|16.6|163/171|c.37.1.17| HM:SCP:REP 1->218|1dekA_|1.9e-44|32.7|211/0|c.37.1.1|1/1|P-loop containing nucleoside triphosphate hydrolases| OP:NHOMO 2100 OP:NHOMOORG 1124 OP:PATTERN --1-1-----------2------111111111----------------11111-1111111---1--- 1221111111111111111-11111111111111111122133311111111313111111111112111111111111111111111111111111--1111111111111111111111111111111111111222221112121111111111111111121122211111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111112111111111111121111111111111111111-112121111111111111221211111112112222222111111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111-1111111111111111111111111111111111212-11111111111111111121111111111111111111111111111111111211-1111211-11111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111112111111111111111121-11111111111111111111111111111111 2212335-E5715563233322333333322123333323333233333333432333332333333323333333333334333322-33623333233243545-355D8C67C86664875F62G4PwD-CBH4653C36963554574584778746756643747C56657796*54345E9ED3CA586B778 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 219 STR:RPRED 100.0 SQ:SECSTR cccEEEEEccTTccHHHHHHHHHHHccccEEEHHHHHHHHHHTTcHHHHHHHHHHTTTccccHHHHHHHHHHHHTcGGGTTcEEEEcccccHHHHHHHHHHHHHTTccccEEEEEEccGGGHHHHHHTEEEETTTccEEETTTcccccTTccTTTccccEEccTTccHHHHHHHHHHHHHHHHHHHHHHHHHTcEEEEEccccHHHHHHHHHHHHGGGc PSIPRED cccEEEEEccccccHHHHHHHHHHHHccEEEEHHHHHHHHHHcccHHHHHHHHHHHccccccHHHHHHHHHHHHHcccccccEEEEcccccHHHHHHHHHHHHHccccccEEEEEEccHHHHHHHHHcccccccccEEEEEEcccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEEccccHHHHHHHHHHHHHHcc //