[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : amyA
DDBJ      :amyA         Alpha-amylase
Swiss-Prot:             

Homologs  Archaea  25/68 : Bacteria  601/915 : Eukaryota  134/199 : Viruses  0/175   --->[See Alignment]
c.1.8
:607 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   126->542 1j0hA PDBj 1e-66 39.0 %
:RPS:PDB   125->536 1cgwA PDBj 9e-51 22.6 %
:RPS:SCOP  124->533 1bvzA3  c.1.8.1 * 2e-49 33.6 %
:HMM:SCOP  123->535 1ji1A3 c.1.8.1 * 9.9e-86 32.0 %
:RPS:PFM   194->492 PF00128 * Alpha-amylase 4e-35 35.0 %
:HMM:PFM   187->499 PF00128 * Alpha-amylase 6.6e-70 31.6 304/316  
:BLT:SWISS 6->544 APU_THEP3 7e-77 38.5 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE00096.1 GT:GENE amyA GT:PRODUCT Alpha-amylase GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION complement(1329755..1331578) GB:FROM 1329755 GB:TO 1331578 GB:DIRECTION - GB:GENE amyA GB:PRODUCT Alpha-amylase GB:NOTE COG0366 [G] Glycosidases GB:PROTEIN_ID ABE00096.1 GB:DB_XREF GI:90821457 GB:GENE:GENE amyA LENGTH 607 SQ:AASEQ MAHILYNAWDSLYKEPFGAVKIDHEVVWRLQVFPDENEEIHYVNLILTKDGEEDVPYALENLNHDGLYQVKLQIGTAGLYFYHFEIETSHGRSYLEKRQGGMAQQVSSQSDLLRFQLTCFDEEVPSPKWYRQGVVYQIFPDRFANGLPNGEVQGRKPNSFIYGTTADKPYYIRDKNNEIVRWDFYGGNLKGILKKLPYLEELGVTTIYLNPIFLSRSNHHYDTADFLKIDPMIGNEDDLKELITEMHKKNMHLILDGVFNHVGKESIYFNASGSYGKNVGAAQSKESPYYSWFDFIHYPDDYKSWWGIKDLPVIDKDNPEYQKFIYGDSNRSVLSKWNNFGIDGWRLDVADELPMNFLRGIRKNLDSHHKQVMIGEVWEDASNKIAYDERRQYTVGDNLTGVMGYPTRIFVMDLLESVKSSQDIKKYCNEYLQLQENYPRDFWLNTLNNIGTHDTQRIKTVLHNDDNKVIQAFRILFNLPGVPCIYYGDEVGVEGDADPDNRRFFPWGQEKNSRIIQEVKQLVDKRKKNILLQEGRLGFVIARGSHCPALAIVRYDDQGNSVYNWLNLTQYKQIISPENGEYLCLPQNIQQKFQHELTLDSWEYKVI GT:EXON 1|1-607:0| BL:SWS:NREP 1 BL:SWS:REP 6->544|APU_THEP3|7e-77|38.5|524/1481| BL:PDB:NREP 1 BL:PDB:REP 126->542|1j0hA|1e-66|39.0|377/588| RP:PDB:NREP 1 RP:PDB:REP 125->536|1cgwA|9e-51|22.6|381/686| RP:PFM:NREP 1 RP:PFM:REP 194->492|PF00128|4e-35|35.0|274/296|Alpha-amylase| HM:PFM:NREP 1 HM:PFM:REP 187->499|PF00128|6.6e-70|31.6|304/316|Alpha-amylase| GO:PFM:NREP 3 GO:PFM GO:0003824|"GO:catalytic activity"|PF00128|IPR006047| GO:PFM GO:0005975|"GO:carbohydrate metabolic process"|PF00128|IPR006047| GO:PFM GO:0043169|"GO:cation binding"|PF00128|IPR006047| RP:SCP:NREP 1 RP:SCP:REP 124->533|1bvzA3|2e-49|33.6|378/382|c.1.8.1| HM:SCP:REP 123->535|1ji1A3|9.9e-86|32.0|394/0|c.1.8.1|1/1|(Trans)glycosidases| OP:NHOMO 2166 OP:NHOMOORG 760 OP:PATTERN --1-1--11111111-2-1--1--3--4113------------------------2-232-111---- 36-17132333-3-13322-23--222222222444-13313223342333155A211--1131513643243223432--13-----1121-4-----5141235245----------------1212211121245466---7237B155111--222221-2-43441-1-----1----9763412-273555555543555555354415555554-378455454-432222222222222211132451-5811525AA22572524426552224333222344445443434222244442222233---333231-152222222727-422-4445-13--281111-1--71-134231-4--13331-----1232212123222------------21311323323-2223542344232142312-333311---------1---2-21------------------------------22-2--1-11111-111111111131-111-11111----1114-1-----15---123-31----------322-1-1--111-------111-231-154142311---------------------------4554-32-3352322223-222-21-2--3---2---------36--2313333333333-33333334333333333334542111-311423333323334242213332--333333343333-------------1-714---242-------------------4B11311212311114111----------133422222365551133333233------11221111--------1-5----1---1-3-----2---31---565334144513- --11221-------177338CAB6475221222----111---1114434677525423343-12-2441--3-547396-2222547-55274855353--1--1--21311111---1--11111--591-11411-11--1-11---1-11-111124625522A6CA1223---3B-------1-2----1---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 595 STR:RPRED 98.0 SQ:SECSTR ############ccTTTEEEEETTEEEEEEEEEEETTcccEEEEEEEcTTccTTcccEEEEEEEEEEEEEEEEcTTccEEEEEEEEEcccccEEEEETTEEEccHHHHccEEEcccccTTccTcTcTTccTTccEEEEcGGGTccccGGGccccTTccTTcccccTccccGGGccTTcccTTccccccHHHHHHHTTHHHHHTccEEEEcccEEEccTTcccEEEEEEEcTTTccHHHHHHHHHHHHHTTcEEEEEEcTTEEEEccTTcTTcTTTTcEEETTEEEEccTTcccccccccTTTTTccccTTEEEccTTcHHHHHHHHTTcTHHHHHHHHHTTccEEEEccGGGccHHHHHHHHHHHHTTcccEEEEcccccTcccTcccHHHHHHHHHcccEEccHHHHHHHHHHHHHHTcccccHHHHHHHHHHHHHHcTTGGcGcEEccccTTccccccHTTccHHHHHHHHHHHHTcccEEEEETTTTTTcccccTTTTccccccccccccHHHHHHHHHTTHHHHcHHHHHcEEcEEEEEEETTTTEEEEEEEETTEEEEEEEEcccccEEEEccccccEEccccccccEEEEEEEcTTcEEEE PSIPRED ccEEEEcccccccccccccEEEccEEEEEEEEccccccEEEEEEEEcccccEEEEEEEEEEcccccEEEEEEEcccccEEEEEEEEEcccccEEEcccccccccccccccccccccccccccccccHHHHccccEEEEEEccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHccccEEEEccccccccccccccccccccccccccHHHHHHHHHHHHHcccEEEEEEcccccccccHHHHHHccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHccccEEEEccHHHccHHHHHHHHHHHHHHcccEEEEEEEcccccccccccccccccccccccccccHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHcccccccccHHcccccccccHHHHccccHHHHHHHHHHHHHccccEEEEccHHHcccccccccccccccccccccHHHHHHHHHHHHHHHHcHHHHcccEEEEEEccccccEEEEEEEcccccEEEEEEEcccccEEEEcccccEEEEEcccccccccEEEEcHHHEEEc //