[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : ansB
DDBJ      :ansB         L-asparaginase
Swiss-Prot:             

Homologs  Archaea  64/68 : Bacteria  535/915 : Eukaryota  105/199 : Viruses  0/175   --->[See Alignment]
c.88.1
:326 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   1->309 2jk0H PDBj 3e-37 36.4 %
:RPS:PDB   1->325 2d6fA PDBj 1e-53 24.9 %
:RPS:SCOP  1->317 1zq1A2  c.88.1.1 * 3e-73 27.9 %
:HMM:SCOP  1->323 2d6fA2 c.88.1.1 * 7.8e-99 41.4 %
:RPS:PFM   4->318 PF00710 * Asparaginase 2e-42 38.1 %
:HMM:PFM   3->313 PF00710 * Asparaginase 9.4e-86 31.0 300/313  
:BLT:SWISS 1->325 ASPG_DEIRA 6e-46 40.1 %
:PROS 6->14|PS00144|ASN_GLN_ASE_1
:PROS 79->89|PS00917|ASN_GLN_ASE_2

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE00027.1 GT:GENE ansB GT:PRODUCT L-asparaginase GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION 1254525..1255505 GB:FROM 1254525 GB:TO 1255505 GB:DIRECTION + GB:GENE ansB GB:PRODUCT L-asparaginase GB:NOTE COG0252 [EJ] L-asparaginase/archaeal Glu-tRNAGln amidotransferase subunit D GB:PROTEIN_ID ABE00027.1 GB:DB_XREF GI:90821388 GB:GENE:GENE ansB LENGTH 326 SQ:AASEQ MKNILILHTGGTIAMSEDQNGAVSPDSSNPLNQFANPFAGKLNLITEDIFNYPSPHIGPKQMLLLEKRILRAADENIDGVVITHGTDTLEETAYFLDLTIPSKFPIVITGAMRSANEIGSDGLHNFQTAIQTAASDEAHGKGVLVVMNDEIHTARYVTKTHTTNVATFRTPTFGPIGLVSKHKVSFFEELLRHTALPIQNVVNHVYLLKAYAGMDNELFDFIASDTSNTNGLVIEALGAGNLPPHVLPSLKKIIDKNIPVVLVSRCFNGIAEDVYSYEGGGVQLKEMGVIFCQGLNGQKARIKLLVGISAGLKGKDLANFVSDAIS GT:EXON 1|1-326:0| BL:SWS:NREP 1 BL:SWS:REP 1->325|ASPG_DEIRA|6e-46|40.1|312/322| PROS 6->14|PS00144|ASN_GLN_ASE_1|PDOC00132| PROS 79->89|PS00917|ASN_GLN_ASE_2|PDOC00132| BL:PDB:NREP 1 BL:PDB:REP 1->309|2jk0H|3e-37|36.4|291/313| RP:PDB:NREP 1 RP:PDB:REP 1->325|2d6fA|1e-53|24.9|321/424| RP:PFM:NREP 1 RP:PFM:REP 4->318|PF00710|2e-42|38.1|307/315|Asparaginase| HM:PFM:NREP 1 HM:PFM:REP 3->313|PF00710|9.4e-86|31.0|300/313|Asparaginase| GO:PFM:NREP 1 GO:PFM GO:0006520|"GO:cellular amino acid metabolic process"|PF00710|IPR006034| RP:SCP:NREP 1 RP:SCP:REP 1->317|1zq1A2|3e-73|27.9|312/363|c.88.1.1| HM:SCP:REP 1->323|2d6fA2|7.8e-99|41.4|319/0|c.88.1.1|1/1|Glutaminase/Asparaginase| OP:NHOMO 933 OP:NHOMOORG 704 OP:PATTERN 1111-11-111111111111-111111-1121111111111111111111111112222121111111 -----12211111111111-1111111111111111-122----2-1--11-----1---21---11-----------11112-----3332-111---1211111-111--------------------------11111---1------------11111---------------------111------12222222121122222113222221111111111111112111111111111111111111111111-11111111111111111111111111111111111111111111111111111211111111-11111111111111-1---11111--1-1---11-----1--111--1--------11111-11----------12222222221-22322222----111------1--1------211-1-1-11111111--------------------------------------1---1111-11111112111111212111111122222-111122222322121121----1-11-11-1---12-----1-1-1-1-----------------11---3211111111111111111-1--1--2211--11-11122221211111111111---1----------21221112222222222-222232222222222222222133112333233333332323312222222--211111111111---1-----1111--1112221111-1111---1111111---1-11111111-2222----222122212-1221-----111--------------------------------------------------------------11-11------1- ----11-----1---123-12211211--11-11--11-1111---2211437322111111-12111-11112115111111111-1-1112111111-2-1--2-----111--------1-11-1-------2-----------------1--11-----2-11111-1411--------2-----1--21-1111 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 325 STR:RPRED 99.7 SQ:SECSTR ccEEEEEEcccccccEEcTTTccEEccTTHHHHHcGGGGGTcEEEccccccccGGGccHHHHHHHHHHHHHHHHTTccEEEEEccTTTHHHHHHHHHHHEEccccEEEEcccccTTcTTcTHHHHHHHHHHHHHcccccEEcccccccEEEEEGGGEEEcccccTTcEEEccccccEEEETTEEcccccccccccEEcccccccEEEEEccTTccHHHHHHHHHTHTTccEEEEEEcTTTcccGGGHHHHHHHHHTTccEEEEETTccccccccTTccHHHHHHHHTTcEEcTTccHHHHHHHHHHHTTTcccHHHHHHHHHccc# PSIPRED ccEEEEEEcccccccccccccccccccHHHHHHHHHHHHHccEEEEEEEEccccccccHHHHHHHHHHHHHHHcccccEEEEEcccccHHHHHHHHHHHHcccccEEEEccccccccccccHHHHHHHHHHHHHccHHcccEEEEEEccEEEcccEEEEEEccccccccccccccEEEEEccEEEEEEccccccccccccccccEEEEEEcccccHHHHHHHHHHcccccEEEEEEEccccccHHHHHHHHHHHHcccEEEEEEcccccccccccccccccHHHHHccEEEcccccHHHHHHHHHHHHHccccHHHHHHHHHcccc //