[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : argG
DDBJ      :argG         Argininosuccinate synthase
Swiss-Prot:ASSY_LACS1   RecName: Full=Argininosuccinate synthase;         EC=6.3.4.5;AltName: Full=Citrulline--aspartate ligase;

Homologs  Archaea  56/68 : Bacteria  757/915 : Eukaryota  175/199 : Viruses  0/175   --->[See Alignment]
c.26.2d.210.1
:403 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   3->391 1vl2C PDBj 9e-94 48.7 %
:RPS:PDB   5->359 2deuA PDBj 4e-51 15.5 %
:RPS:SCOP  5->166 1j1zA1  c.26.2.1 * 8e-67 50.6 %
:RPS:SCOP  173->397 1k92A2  d.210.1.1 * 2e-60 24.4 %
:HMM:SCOP  1->171 1k92A1 c.26.2.1 * 4.8e-53 46.2 %
:HMM:SCOP  172->396 1korA2 d.210.1.1 * 8.8e-95 58.7 %
:RPS:PFM   7->392 PF00764 * Arginosuc_synth e-139 61.1 %
:HMM:PFM   7->393 PF00764 * Arginosuc_synth 1.8e-177 58.7 387/390  
:BLT:SWISS 1->403 ASSY_LACS1 0.0 100.0 %
:PROS 9->17|PS00564|ARGININOSUCCIN_SYN_1
:PROS 116->127|PS00565|ARGININOSUCCIN_SYN_2

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABD99120.1 GT:GENE argG GT:PRODUCT Argininosuccinate synthase GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION complement(331450..332661) GB:FROM 331450 GB:TO 332661 GB:DIRECTION - GB:GENE argG GB:PRODUCT Argininosuccinate synthase GB:NOTE COG0137 [E] Argininosuccinate synthase GB:PROTEIN_ID ABD99120.1 GB:DB_XREF GI:90820481 GB:GENE:GENE argG LENGTH 403 SQ:AASEQ MEKGKVVLAYSGGLDTSVEIAWLKNKGYDVIACCIDVGEGKDLEAIKEKGLKVGAVESIVIDAKHEFAEEYVLPALQGHAYYENKYPLVSALSRPLIVKKLVEVAKEHGATAIAHGCTGKGNDQVRFEVGIHALVPEMKIEDPIRDLHWSREEEIEYAKENGIPVPISKKSPYSIDENLWGRANECGILEDPWQSAPADAYDRTVALEDTPDTPDVIEITFDKGVPTKLDGEELPLEELIMKLDKLAGKHGIGRIDHVENRLVGIKSREVYECPAATVLLAAHKDMEDLTHERDLAHFKPIIEQKLSELIYNGLWFSPLMDAIQAFLAETQKVVNGVVRVKLFKGNVICEGRKSPNSLYSEELATYTSADQFDQEAAAGFIKLWGLPTQVYAEVMQQNEKNNK GT:EXON 1|1-403:0| SW:ID ASSY_LACS1 SW:DE RecName: Full=Argininosuccinate synthase; EC=6.3.4.5;AltName: Full=Citrulline--aspartate ligase; SW:GN Name=argG; OrderedLocusNames=LSL_0306; SW:KW Amino-acid biosynthesis; Arginine biosynthesis; ATP-binding;Complete proteome; Cytoplasm; Ligase; Nucleotide-binding. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->403|ASSY_LACS1|0.0|100.0|403/403| GO:SWS:NREP 6 GO:SWS GO:0008652|"GO:cellular amino acid biosynthetic process"|Amino-acid biosynthesis| GO:SWS GO:0006526|"GO:arginine biosynthetic process"|Arginine biosynthesis| GO:SWS GO:0005524|"GO:ATP binding"|ATP-binding| GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0016874|"GO:ligase activity"|Ligase| GO:SWS GO:0000166|"GO:nucleotide binding"|Nucleotide-binding| PROS 9->17|PS00564|ARGININOSUCCIN_SYN_1|PDOC00488| PROS 116->127|PS00565|ARGININOSUCCIN_SYN_2|PDOC00488| BL:PDB:NREP 1 BL:PDB:REP 3->391|1vl2C|9e-94|48.7|380/393| RP:PDB:NREP 1 RP:PDB:REP 5->359|2deuA|4e-51|15.5|330/364| RP:PFM:NREP 1 RP:PFM:REP 7->392|PF00764|e-139|61.1|386/390|Arginosuc_synth| HM:PFM:NREP 1 HM:PFM:REP 7->393|PF00764|1.8e-177|58.7|387/390|Arginosuc_synth| GO:PFM:NREP 3 GO:PFM GO:0004055|"GO:argininosuccinate synthase activity"|PF00764|IPR001518| GO:PFM GO:0005524|"GO:ATP binding"|PF00764|IPR001518| GO:PFM GO:0006526|"GO:arginine biosynthetic process"|PF00764|IPR001518| RP:SCP:NREP 2 RP:SCP:REP 5->166|1j1zA1|8e-67|50.6|162/165|c.26.2.1| RP:SCP:REP 173->397|1k92A2|2e-60|24.4|225/256|d.210.1.1| HM:SCP:REP 1->171|1k92A1|4.8e-53|46.2|171/188|c.26.2.1|1/1|Adenine nucleotide alpha hydrolases-like| HM:SCP:REP 172->396|1korA2|8.8e-95|58.7|225/225|d.210.1.1|1/1|Argininosuccinate synthetase, C-terminal domain| OP:NHOMO 1104 OP:NHOMOORG 988 OP:PATTERN ---1-11111111111-1111111111111111111111111111111111111-1-----1111-11 1111111111111111111-11111111111111111111111111111111111111--121111121211111111--11111111111111---111-1-1111111---------------11111111111111111111111111111111111111111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111----11-1---111111-1-111111111----111111111--1-1-------------111111111111-1111111111111111111-1111-1111111111-11111111--1111111111--1111111111111111111111111-1121111111112112121222111111111111111111111111111111111---11111---------------------11111111111111111111111111222221111111111111111111111111111111111111111111111-111111111111111111111111111112111111111111-1-------1111111111111111111111111111111111111-1-111111111111111111111111111-111111111111111111111111221111111111111111111111111--111111111111---1-----111111111111111111111111111111111111111111111111111111--------111111111111122111111111111111111111111-------------------------------------11--11111111 ------1-11--11111111111121111111111111111111112121222221111111-11111-1111111111111111111-11111121111121112-11-21212111111111211B1AR2-552-1-121112-1-1-11-2131-2132131111112--11111181111111221121121111 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 397 STR:RPRED 98.5 SQ:SECSTR cTccEEEEEccccHHHHHHHHHHHHHccEEEEEEEccccccccHHHHHHHHHHHHHHHHEEcTHHHHHHHTHHHHHHHHHTTccccHHHHHcccccTTHHHHHHHTTcccccEEccEEEEcccTTcccGGGGTTccHHHHHTEEccGGccHHHHHHHHHHHTcTTcHHHcccccccccccccccHHHHHTTTccccccEEEcccccEEEEccccTTccTTccTTccccccEcTTcTTTcEEEcccccccccEEEEETTTTEEEEEcccTTcGGGEEEEEEEccccccEEEEEEcccTTcccEEEEEEEcccccEEEEHHHHHHHHTEEEEEETccTTccccEEccccEEEcccEEEEEEHHHHHHHHccccEEcccccccccTTcEEEEcccccEEH###### DISOP:02AL 1-2,391-404| PSIPRED ccccEEEEEEEcccHHHHHHHHHHHcccEEEEEEEEcccccHHHHHHHHHHHcccccEEEEEHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHccccEEEEcccccccccccHHHHHHHHccccEEEEEEccccccHHHHHHHHHHccccccccccccccccccccccHHcccccccccccccHHHHHccccHHHccccccEEEEEEcccEEEEEccEEccHHHHHHHHHHHHHHcccccEEEEEccEEEEEEcHHHccHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHccEEEEEEEEEEEccEEEEEEEEcccccccHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccc //