[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : arsC.2
DDBJ      :arsC         Arsenate reductase
Swiss-Prot:             

Homologs  Archaea  12/68 : Bacteria  170/915 : Eukaryota  6/199 : Viruses  0/175   --->[See Alignment]
c.44.1
:137 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->112 2cd7A PDBj 2e-18 45.0 %
:RPS:PDB   1->112 2cd7A PDBj 2e-24 45.0 %
:RPS:SCOP  2->112 1jf8A  c.44.1.1 * 1e-23 41.7 %
:HMM:SCOP  2->129 1jf8A_ c.44.1.1 * 1.4e-27 38.9 %
:RPS:PFM   5->109 PF01451 * LMWPc 4e-07 36.5 %
:HMM:PFM   5->126 PF01451 * LMWPc 4.1e-19 30.6 121/140  
:BLT:SWISS 1->112 ARSC1_STAEQ 3e-18 43.6 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABD99698.1 GT:GENE arsC.2 GT:PRODUCT Arsenate reductase GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION complement(912312..912725) GB:FROM 912312 GB:TO 912725 GB:DIRECTION - GB:GENE arsC GB:PRODUCT Arsenate reductase GB:NOTE COG0394 [T] Protein-tyrosine-phosphatase GB:PROTEIN_ID ABD99698.1 GB:DB_XREF GI:90821059 GB:GENE:GENE arsC LENGTH 137 SQ:AASEQ MEKPKVAFICVHNSCRSQIAEALGKYLAADVFESFSAGTETVPQINQDAVRLIKEIYQIDMEETQSSKLLSELPQVDIVITMGCNVNCPVIPCKYREDWGLDDPTGKEDAEFLKIIHLIHDNILNLSERISKNELFS GT:EXON 1|1-137:0| BL:SWS:NREP 1 BL:SWS:REP 1->112|ARSC1_STAEQ|3e-18|43.6|110/132| SEG 113->126|lkiihlihdnilnl| BL:PDB:NREP 1 BL:PDB:REP 1->112|2cd7A|2e-18|45.0|109/131| RP:PDB:NREP 1 RP:PDB:REP 1->112|2cd7A|2e-24|45.0|109/131| RP:PFM:NREP 1 RP:PFM:REP 5->109|PF01451|4e-07|36.5|104/141|LMWPc| HM:PFM:NREP 1 HM:PFM:REP 5->126|PF01451|4.1e-19|30.6|121/140|LMWPc| GO:PFM:NREP 2 GO:PFM GO:0004725|"GO:protein tyrosine phosphatase activity"|PF01451|IPR017867| GO:PFM GO:0006470|"GO:protein amino acid dephosphorylation"|PF01451|IPR017867| RP:SCP:NREP 1 RP:SCP:REP 2->112|1jf8A|1e-23|41.7|108/130|c.44.1.1| HM:SCP:REP 2->129|1jf8A_|1.4e-27|38.9|126/0|c.44.1.1|1/1|Phosphotyrosine protein phosphatases I| OP:NHOMO 227 OP:NHOMOORG 188 OP:PATTERN -------------------------------------112111--1-11------1--1-1------- -1--3--2111-1-21-11-12--1111111-212143121121-1-11---311------21---11211-----2-----111111-----1------------------------------------1----------111-1-11-111----------11-1111------------------11-11-111111211112-111111-1111121-1--------111-1-1-1111---1111222---2--21-------11-1---------------------------------------------------1121111123111111-11-1111-21--2---41----11--1111-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11---1-1--------1---11--1111--------1-1----------------------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------1- ------------12------21-----------1------------------------------------------------------------------------------------------------------------------------------------------------------1-------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 112 STR:RPRED 81.8 SQ:SECSTR cccEEEEEEETTcccHHHHHHHHHHHHcTTTEEEEEEEccccccccHHHHHHHHHHTTcccTTccccccccHHHHccEEEEccHHHTcccccTccEEEccccccTTccHHHH######################### DISOP:02AL 1-1,135-138| PSIPRED ccccEEEEEEcccccHHHHHHHHHHHHccccEEEEEccccccccccHHHHHHHHHHcccccccccccccHHHHHHccEEEEEcccccccccccccEEEccccccccccHHHHHHHHHHHHHHHHHHHHHHHcccccc //