[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : asnA
DDBJ      :asnA         Aspartate--ammonia ligase
Swiss-Prot:ASNA_LACS1   RecName: Full=Aspartate--ammonia ligase;         EC=6.3.1.1;AltName: Full=Asparagine synthetase A;

Homologs  Archaea  0/68 : Bacteria  219/915 : Eukaryota  7/199 : Viruses  0/175   --->[See Alignment]
d.104.1
:336 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   19->321 11asA PDBj 7e-86 54.5 %
:RPS:PDB   14->329 11asA PDBj 1e-20 39.9 %
:RPS:SCOP  14->330 11asA  d.104.1.1 * e-137 52.1 %
:HMM:SCOP  14->329 12asA_ d.104.1.1 * 6.4e-100 39.8 %
:RPS:PFM   14->241 PF03590 * AsnA 1e-82 63.7 %
:RPS:PFM   226->278 PF04685 * DUF608 6e-04 41.5 %
:HMM:PFM   17->246 PF03590 * AsnA 3.5e-89 52.2 228/244  
:BLT:SWISS 1->336 ASNA_LACS1 0.0 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABD99841.1 GT:GENE asnA GT:PRODUCT Aspartate--ammonia ligase GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION complement(1056646..1057656) GB:FROM 1056646 GB:TO 1057656 GB:DIRECTION - GB:GENE asnA GB:PRODUCT Aspartate--ammonia ligase GB:NOTE COG2502 [E] Asparagine synthetase A GB:PROTEIN_ID ABD99841.1 GB:DB_XREF GI:90821202 GB:GENE:GENE asnA LENGTH 336 SQ:AASEQ MDLIIPKDYDPKLSIRETQEAIRYIRETFQDEFGKEMGLNRVSAPMYVEKSSGINDNLNGYEKPVSFTMKDMPGETIEVVHSLAKWKRMALKKYGFGLHEGLYTNMNAIRKDEDLDNFHSSYVDQWDWEKVISKDERNEKTLKETVELIFKVVKHMEHEVWYKFPNAVYHLPDKIHFITSQELEDKYPELEDAKDRENAICKELGCVFVMQIGDVLKSGKRHDGRAPDYDDWKLNGDILFWYEPLQCALELSSMGIRVDEDSMVEQLKKTGDEDRLKLQYHKMILNKELPYTIGGGIGQSRLCMLLLGKAHVGEVQASIWPDEMLKKCEENGIHIL GT:EXON 1|1-336:0| SW:ID ASNA_LACS1 SW:DE RecName: Full=Aspartate--ammonia ligase; EC=6.3.1.1;AltName: Full=Asparagine synthetase A; SW:GN Name=asnA; OrderedLocusNames=LSL_1033; SW:KW Amino-acid biosynthesis; Asparagine biosynthesis; ATP-binding;Complete proteome; Cytoplasm; Ligase; Nucleotide-binding. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->336|ASNA_LACS1|0.0|100.0|336/336| GO:SWS:NREP 6 GO:SWS GO:0008652|"GO:cellular amino acid biosynthetic process"|Amino-acid biosynthesis| GO:SWS GO:0006529|"GO:asparagine biosynthetic process"|Asparagine biosynthesis| GO:SWS GO:0005524|"GO:ATP binding"|ATP-binding| GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0016874|"GO:ligase activity"|Ligase| GO:SWS GO:0000166|"GO:nucleotide binding"|Nucleotide-binding| BL:PDB:NREP 1 BL:PDB:REP 19->321|11asA|7e-86|54.5|301/327| RP:PDB:NREP 1 RP:PDB:REP 14->329|11asA|1e-20|39.9|316/327| RP:PFM:NREP 2 RP:PFM:REP 14->241|PF03590|1e-82|63.7|226/233|AsnA| RP:PFM:REP 226->278|PF04685|6e-04|41.5|53/335|DUF608| HM:PFM:NREP 1 HM:PFM:REP 17->246|PF03590|3.5e-89|52.2|228/244|AsnA| GO:PFM:NREP 6 GO:PFM GO:0004071|"GO:aspartate-ammonia ligase activity"|PF03590|IPR004618| GO:PFM GO:0005737|"GO:cytoplasm"|PF03590|IPR004618| GO:PFM GO:0006529|"GO:asparagine biosynthetic process"|PF03590|IPR004618| GO:PFM GO:0004348|"GO:glucosylceramidase activity"|PF04685|IPR006775| GO:PFM GO:0006665|"GO:sphingolipid metabolic process"|PF04685|IPR006775| GO:PFM GO:0016021|"GO:integral to membrane"|PF04685|IPR006775| RP:SCP:NREP 1 RP:SCP:REP 14->330|11asA|e-137|52.1|315/328|d.104.1.1| HM:SCP:REP 14->329|12asA_|6.4e-100|39.8|314/0|d.104.1.1|1/1|Class II aaRS and biotin synthetases| OP:NHOMO 229 OP:NHOMOORG 226 OP:PATTERN -------------------------------------------------------------------- -11---------------------------------------------------------------------------1--1------1111-1------1---------------------------------------------------------------------------------------------111111111111111------111-----11-----------------------------111--111111111---11------1111111---111111111111111111111111-111111111-11--111111111111--111111111--1----------------111-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11-----1-1---------------------------------11--11-1111111111-11111111111111111111111111111-111111111111111111111--111111111111---1--------------111111111111111--------------------------------------------------------------------------------------11------1-1-11-----21--1111------------- --11----211-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------21----- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 316 STR:RPRED 94.0 SQ:SECSTR #############ccHHHHHHHHHHHHHHHHHHHHHHcEEEcccccEEETTccccccTTccccccEEcccccTTccEEEccccTTHHHHHHHHTTccTTcEEEcEEEEEcTTcccccccccEEEEEEEEEEccTTcccHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccEEEEHHHHHHHcccccHHHHHHHHHHHHcEEEEEccccccccccccccccTTcccTTcccccEEEEEEEETTTTEEEEEEEEEEcccHHHHHHHHHHHTcTTTTTcHHHHHHHTTccccEEEEEEEHHHHHHHHHTcccGGGTccccccHHHHHHcc####### DISOP:02AL 1-1| PSIPRED cEEEccccccccccHHHHHHHHHHHHHHHHHHHHHHHcEEEEEccEEEEcccccccccccccccEEEEcccccccEEEEEHHHHHHHHHHHHHccccccccEEEEccccccccccccccEEEEEcccHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccEEEEEcHHHHHHHccccccHHHHHHHHHHHHccEEEEEEcccccccccccccccccccccccccEEEEEcccccEEEEEEccEEEcHHHHHHHHHHHcHHHHHccHHHHHHHcccccEEEcccHHHHHHHHHHHcccccEEEEEccccHHHHHHHHHcccccc //