[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : azlC.2
DDBJ      :azlC         Branched-chain amino acid transport protein
Swiss-Prot:             

Homologs  Archaea  4/68 : Bacteria  250/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:235 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   35->157 PF03591 * AzlC 4e-14 40.2 %
:HMM:PFM   15->157 PF03591 * AzlC 9.4e-44 39.4 142/143  
:BLT:SWISS 45->180 Y1331_HELPY 3e-11 30.1 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE00446.1 GT:GENE azlC.2 GT:PRODUCT Branched-chain amino acid transport protein GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION 1732323..1733030 GB:FROM 1732323 GB:TO 1733030 GB:DIRECTION + GB:GENE azlC GB:PRODUCT Branched-chain amino acid transport protein GB:NOTE COG1296 [E] Predicted branched-chain amino acid permease (azaleucine resistance) GB:PROTEIN_ID ABE00446.1 GB:DB_XREF GI:90821807 GB:GENE:GENE azlC LENGTH 235 SQ:AASEQ MNAELNRKTAIKEVLPTAFGYIGIGIAFGIVSKAAGLSALQAGLMSLIAYGGSAQFIIVSMLLVYSPIISIITAAFLVNSRMILMSLVTAKYFKNDSMLHNILIGSLLTDESFALAMNKLNYTNNKLNFAWFDTANWFAYFVWFFSSVLGALVGNFIENPTNLGIDFALVAMFIGLLYLQMISDKSLKLSLQLLVVVATFILVYLGLIFIPSNLLIIIITLLGCAVGMVLKHVFF GT:EXON 1|1-235:0| BL:SWS:NREP 1 BL:SWS:REP 45->180|Y1331_HELPY|3e-11|30.1|133/228| TM:NTM 7 TM:REGION 15->37| TM:REGION 42->64| TM:REGION 70->92| TM:REGION 137->159| TM:REGION 163->185| TM:REGION 188->210| TM:REGION 214->235| SEG 18->30|afgyigigiafgi| SEG 185->197|kslklslqllvvv| SEG 207->222|lifipsnlliiiitll| RP:PFM:NREP 1 RP:PFM:REP 35->157|PF03591|4e-14|40.2|122/142|AzlC| HM:PFM:NREP 1 HM:PFM:REP 15->157|PF03591|9.4e-44|39.4|142/143|AzlC| OP:NHOMO 275 OP:NHOMOORG 254 OP:PATTERN --------------------------------------1111-------------------------- --------------------------------------------------------------------------------11--------------------------------------------------------------2----------------------------------------1------211111112111111111-111-111111111-11111111-11111111111111111111-2--1-1---221111-21-1-111111----1111--111-1111-------------111111111--1--1---------1-1------1--111---111-1111-1111------------------------------11111111111---------11---22121111211------1------1----------------------------------------------1------11-2122221-----11111111121121111----1-------------2----11--------------11-1111111111-1----1----------1-11---------1111111--------11111----11-1111-1-111111--11-------------------1----------------------------------11--------------------------------------------------------1-2111-1---------11211111-----11-1--1-1----1-----------------11111--1-------------------1------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-1| PSIPRED ccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc //