[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : birA
DDBJ      :birA         Biotin operon repressor / Biotin--[acetyl-CoA-carboxylase] synthetase
Swiss-Prot:             

Homologs  Archaea  37/68 : Bacteria  472/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.4.5b.34.1d.104.1
:321 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   16->57 1q1hA PDBj 2e-04 42.9 %
:BLT:PDB   84->321 1wnlA PDBj 1e-18 36.8 %
:RPS:PDB   4->73 2ek5B PDBj 7e-07 15.9 %
:RPS:PDB   79->320 2ej9A PDBj 8e-35 29.3 %
:RPS:SCOP  11->60 1j5yA1  a.4.5.1 * 7e-10 28.6 %
:RPS:SCOP  81->266 1wnlA2  d.104.1.2 * 1e-23 30.5 %
:RPS:SCOP  277->317 1biaA2  b.34.1.1 * 3e-08 36.6 %
:HMM:SCOP  2->62 1biaA1 a.4.5.1 * 1.3e-08 32.2 %
:HMM:SCOP  64->275 1biaA3 d.104.1.2 * 9e-50 33.8 %
:HMM:PFM   91->213 PF03099 * BPL_LplA_LipB 1.4e-19 29.2 113/125  
:HMM:PFM   6->58 PF08279 * HTH_11 1.1e-16 38.5 52/55  
:HMM:PFM   277->316 PF02237 * BPL_C 1.8e-07 32.5 40/48  
:BLT:SWISS 5->305 BIRA_BACSU 3e-32 32.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABD99138.1 GT:GENE birA GT:PRODUCT Biotin operon repressor / Biotin--[acetyl-CoA-carboxylase] synthetase GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION complement(354228..355193) GB:FROM 354228 GB:TO 355193 GB:DIRECTION - GB:GENE birA GB:PRODUCT Biotin operon repressor / Biotin--[acetyl-CoA-carboxylase] synthetase GB:NOTE COG0340 [H] Biotin-(acetyl-CoA carboxylase) ligase GB:PROTEIN_ID ABD99138.1 GB:DB_XREF GI:90820499 GB:GENE:GENE birA LENGTH 321 SQ:AASEQ MNTEKAVLNYFIQNLGNYTSGEELSNQLNISRTAVWKAVKQLKEQGYEISSKTRKGYCLVDNGVLNTAFINKYLHTDNLDLHVYETIGSTNSEAKNISSQRHSTEPLVIISDQQTAGYGRYGRKFESPKNTGIYMSILLENQHQNDLNPGLLTTAVAIAVSRTIKKLFHKDTEIKWVNDVLLDGKKICGILTEGVANLETQSISQVIIGIGINYTTPLELFPAELRERVGSLKELAEKYHVSRNMFIACCLDEFFAIYRNYTSADFMDEYRELSVVIGKEVRIKQGNKIITGVVSTIDDLGRIVLTDGQIFSSGEVTKIRY GT:EXON 1|1-321:0| BL:SWS:NREP 1 BL:SWS:REP 5->305|BIRA_BACSU|3e-32|32.0|297/325| SEG 201->212|qsisqviigigi| BL:PDB:NREP 2 BL:PDB:REP 16->57|1q1hA|2e-04|42.9|42/85| BL:PDB:REP 84->321|1wnlA|1e-18|36.8|209/235| RP:PDB:NREP 2 RP:PDB:REP 4->73|2ek5B|7e-07|15.9|69/108| RP:PDB:REP 79->320|2ej9A|8e-35|29.3|225/237| HM:PFM:NREP 3 HM:PFM:REP 91->213|PF03099|1.4e-19|29.2|113/125|BPL_LplA_LipB| HM:PFM:REP 6->58|PF08279|1.1e-16|38.5|52/55|HTH_11| HM:PFM:REP 277->316|PF02237|1.8e-07|32.5|40/48|BPL_C| RP:SCP:NREP 3 RP:SCP:REP 11->60|1j5yA1|7e-10|28.6|49/65|a.4.5.1| RP:SCP:REP 81->266|1wnlA2|1e-23|30.5|164/188|d.104.1.2| RP:SCP:REP 277->317|1biaA2|3e-08|36.6|41/47|b.34.1.1| HM:SCP:REP 2->62|1biaA1|1.3e-08|32.2|59/0|a.4.5.1|1/1|"Winged helix" DNA-binding domain| HM:SCP:REP 64->275|1biaA3|9e-50|33.8|204/207|d.104.1.2|1/1|Class II aaRS and biotin synthetases| OP:NHOMO 528 OP:NHOMOORG 509 OP:PATTERN ------1---------1------11-111-111111--111111121111111-1212111-----11 11---11111111-1------1---1------1---1111--11------111----111-11--1111-1--------11----111--------1---1-1--11------------------111111111-11----1111--1--11--------------11-1------------------11-111111111111111111111121111111111111111111111111111111111111111-111111-1-2211112111212121111111111111111111111111111111111111111111111121111111111111111111111-111111111111111111112---2------1--1---------1-------------1-----------1--------------1----------------------------111111---------11-----1--1-----------------------------------------------------------11---1-11--------111---11-1--1---111-11111111111111-22---------------------------111111111111111111111111111111---11--------11-11111111111111-111111111111111111111111111111111111111111111111111--111111111111--1111111111111111---1-111--1---1----------11111111111111111111-1-1111--111-1111111---11------------1-12--------------1---------------------------1-1--11111-1- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 321 STR:RPRED 100.0 SQ:SECSTR ccTHHHHHHTcccTTcccccHHHHHHHHTccHHHHHHHHHHHHHTTcccEEETTTEEEccccccccHHHHHHHHccTTcEEEEEcccccHHHHHHHHHHHHTTcccEEEEEccccccccGGGccccccTTTcEEEEEEEcTTETTcccHHHHHHHHHHHHHHHHTTTccccEEEETTTEEEEEEEEEEEEEEEEcccEEEEEEEEcccccccGcccccccccTGGGGTcccHHHHHccccccHHHHHHHHHHHHHHHHHHHHTHHHHHHHHHHcccTTcEEEEETTccEEEEEEEEEcccEEEEEETTEEEEGGGEEEEcc DISOP:02AL 1-2| PSIPRED ccHHHHHHHHHHHcccccccHHHHHHHHcccHHHHHHHHHHHHHcccEEEEEcccEEEEEccccccHHHHHHccccccccEEEEccccHHHHHHHHHHHHccccccEEEEEcccccccccccccEEcccccEEEEEEEEcccccHHHHHHHHHHHHHHHHHHHHHHccccccEEEcccEEEEccEEEEEEEEEEEccccccccEEEEEEEEEcccccHHHcHHHcccHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHccccEEEEEEccEEEEEEEEEEcccccEEEEEccEEEccEEEEEEc //