[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : comEB
DDBJ      :comEB        ComE operon protein 2
Swiss-Prot:             

Homologs  Archaea  19/68 : Bacteria  287/915 : Eukaryota  149/199 : Viruses  8/175   --->[See Alignment]
c.97.1
:158 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   5->140 2hvwB PDBj 2e-42 55.1 %
:RPS:PDB   8->132 3b8fC PDBj 4e-23 10.9 %
:RPS:SCOP  1->141 1vq2A  c.97.1.2 * 3e-28 33.3 %
:HMM:SCOP  9->158 1vq2A_ c.97.1.2 * 1.2e-35 37.2 %
:RPS:PFM   10->117 PF00383 * dCMP_cyt_deam_1 3e-12 41.9 %
:HMM:PFM   8->118 PF00383 * dCMP_cyt_deam_1 2.8e-27 36.5 96/102  
:BLT:SWISS 4->144 COMEB_BACSU 1e-54 64.5 %
:PROS 72->107|PS00903|CYT_DCMP_DEAMINASES

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABD99489.1 GT:GENE comEB GT:PRODUCT ComE operon protein 2 GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION 727544..728020 GB:FROM 727544 GB:TO 728020 GB:DIRECTION + GB:GENE comEB GB:PRODUCT ComE operon protein 2 GB:NOTE COG2131 [F] Deoxycytidylate deaminase GB:PROTEIN_ID ABD99489.1 GB:DB_XREF GI:90820850 GB:GENE:GENE comEB LENGTH 158 SQ:AASEQ MTDKRIPWNQYFMLQAVLLSLRSTCERLSVGAILVRDKRVIAGGYNGAVSGDDHCIDVGCYVVDGHCLRTIHAEMNAVLQCSKFGIPTDGAEIYVTDFPCLQCTKSLLQAGIKKIYYMRNYHNDDYAIRLLKRKKVAVEQVKVEPKYLNTVSINIAEN GT:EXON 1|1-158:0| BL:SWS:NREP 1 BL:SWS:REP 4->144|COMEB_BACSU|1e-54|64.5|141/189| PROS 72->107|PS00903|CYT_DCMP_DEAMINASES|PDOC00702| BL:PDB:NREP 1 BL:PDB:REP 5->140|2hvwB|2e-42|55.1|136/146| RP:PDB:NREP 1 RP:PDB:REP 8->132|3b8fC|4e-23|10.9|119/140| RP:PFM:NREP 1 RP:PFM:REP 10->117|PF00383|3e-12|41.9|93/100|dCMP_cyt_deam_1| HM:PFM:NREP 1 HM:PFM:REP 8->118|PF00383|2.8e-27|36.5|96/102|dCMP_cyt_deam_1| GO:PFM:NREP 2 GO:PFM GO:0008270|"GO:zinc ion binding"|PF00383|IPR002125| GO:PFM GO:0016787|"GO:hydrolase activity"|PF00383|IPR002125| RP:SCP:NREP 1 RP:SCP:REP 1->141|1vq2A|3e-28|33.3|135/173|c.97.1.2| HM:SCP:REP 9->158|1vq2A_|1.2e-35|37.2|145/0|c.97.1.2|1/1|Cytidine deaminase-like| OP:NHOMO 494 OP:NHOMOORG 463 OP:PATTERN -----------------------1----------------------1-11211-1111111111--11 ---------------------------------------------------------------1---------------1111-----1111-1111--111111-11-1---------------11111111111-----111---11-111-----------------1-------------------111111111111111111111111111111111--111111-1111111111111111111111111-11111111111111111-111111111111111111111111111111111111111111111111111-----------1211-111--11111111111111-1111111-11-----------------------------------------------------------------------------------------1----------------------------------------------------------------------------2-------1------------------------1111111111111-111111111111111111-------------------1----------------------111----1-11--1-----------------------------------------------------1-1-------------------------------------------------------------------------------1--------------------------------11111111111111----------------1---------------111----1--11-11----11--11---1111111111-1- --11--------1111111--11-1-111-111-11-211--111111111111--111---11111111111111111111111111-1211-11111111-11--11-1121-1-11-1-1111-1-342-122111-21-11-1-1-1--1-11112311111-211-11111---91111111121111111111 -------------------1---------------111-1--------------------------------------------------1-----1---------------------------------------------------------------------------1-- STR:NPRED 152 STR:RPRED 96.2 SQ:SECSTR cccccHHHHHHHHHHHHHHHHHHcccccEEEEEEEETTccEEEEcccccccGGGcccTTHHHHHHHHHHHTccEEEEEEEEEcHHHHHcTTcccEEccccHHHHHHHGGGcTTcEEEcccTTccccEEEHHHHcTTcGGGGGHHcEEccccc###### DISOP:02AL 1-3,157-159| PSIPRED cccccccHHHHHHHHHHHHHHHcccccccEEEEEEEccEEEEEEccccccccccccHHHHccccccccccHHHHHHHHHHHHHccccccccEEEEEccccHHHHHHHHHccccEEEEEccccccHHHHHHHHHcccEEEEEEccHHHHHHcccccccc //