[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : comFC
DDBJ      :comFC        ComF operon protein 3
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  122/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.61.1
:228 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   185->219 1oroB PDBj 6e-04 37.1 %
:RPS:PDB   128->228 1a95B PDBj 7e-08 14.9 %
:RPS:SCOP  177->227 1u9yA2  c.61.1.2 * 5e-06 25.5 %
:HMM:SCOP  90->228 1oreA_ c.61.1.1 * 1.4e-13 27.7 %
:RPS:PFM   168->227 PF00156 * Pribosyltran 4e-04 35.0 %
:HMM:PFM   158->226 PF00156 * Pribosyltran 7.2e-08 32.3 65/125  
:HMM:PFM   29->64 PF07191 * DUF1407 0.00056 36.1 36/70  
:BLT:SWISS 1->228 COMFC_BACSU 1e-25 34.4 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE00014.1 GT:GENE comFC GT:PRODUCT ComF operon protein 3 GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION complement(1238432..1239118) GB:FROM 1238432 GB:TO 1239118 GB:DIRECTION - GB:GENE comFC GB:PRODUCT ComF operon protein 3 GB:NOTE COG1040 [R] Predicted amidophosphoribosyltransferases GB:PROTEIN_ID ABE00014.1 GB:DB_XREF GI:90821375 GB:GENE:GENE comFC LENGTH 228 SQ:AASEQ MNCLLCNNTIDFKLNIKWILSLEKYKRDNVCKRCREELGKCKIDNACEGCGREQKKLLLCNDCIKWKNNNKILLNNKSIYTYDNLIIKKYFERYKFMGDYYWRKIFNIEFKNFITNNYPSKDWIYIPIPVDEYTMQHRGFNQVEGLIGDLPYSRVLKMKKLKRDKKQSEKSRSERLKTQQPFEYIGDKLQGNYVIIDDVYTTGRTLYYAQELLLKNGASRVCSVTLAR GT:EXON 1|1-228:0| BL:SWS:NREP 1 BL:SWS:REP 1->228|COMFC_BACSU|1e-25|34.4|221/229| SEG 64->77|ikwknnnkillnnk| SEG 157->166|kmkklkrdkk| BL:PDB:NREP 1 BL:PDB:REP 185->219|1oroB|6e-04|37.1|35/206| RP:PDB:NREP 1 RP:PDB:REP 128->228|1a95B|7e-08|14.9|101/150| RP:PFM:NREP 1 RP:PFM:REP 168->227|PF00156|4e-04|35.0|60/116|Pribosyltran| HM:PFM:NREP 2 HM:PFM:REP 158->226|PF00156|7.2e-08|32.3|65/125|Pribosyltran| HM:PFM:REP 29->64|PF07191|0.00056|36.1|36/70|DUF1407| GO:PFM:NREP 1 GO:PFM GO:0009116|"GO:nucleoside metabolic process"|PF00156|IPR000836| RP:SCP:NREP 1 RP:SCP:REP 177->227|1u9yA2|5e-06|25.5|51/119|c.61.1.2| HM:SCP:REP 90->228|1oreA_|1.4e-13|27.7|130/179|c.61.1.1|1/1|PRTase-like| OP:NHOMO 122 OP:NHOMOORG 122 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111111111111111111111111111111111111111--111111111111111-----111-11-111111111111111111111111-11111111111111111111111111111111111111---------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 151 STR:RPRED 66.2 SQ:SECSTR #############################################################################ccEEGTTccHHHHHHHHHHHHHHHHHHHTTHHHHHHHHHTccEEEEEEEEEEccHHHHHHHHHHHHHHTcccTHHHHHHHHHHTcccEEEEEEEccEETTEEccEEEEccccccTEEEEEEEEcccHHHHHHHHHcTTcEEEEEEEcTTTG DISOP:02AL 158-182| PSIPRED cccccccccccccccHHHHHcccccccccccHHHHHHcccccccccccccccccccccccHHHHccccccEEEEccccccccccHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHcccccEEEEEccccHHHHHHccccHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHccccEEEEcccccccEEEEEcccccHHHHHHHHHHHHHccccEEEEEEEEc //