[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : dAK.2
DDBJ      :dAK          Dihydroxyacetone kinase
Swiss-Prot:             

Homologs  Archaea  2/68 : Bacteria  301/915 : Eukaryota  169/199 : Viruses  0/175   --->[See Alignment]
c.119.1
:331 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   2->331 3ct4A PDBj e-106 61.0 %
:RPS:PDB   2->331 3ct4A PDBj e-123 62.9 %
:RPS:SCOP  1->331 1un8A4  c.119.1.2 * e-104 32.0 %
:HMM:SCOP  10->331 1oi2A_ c.119.1.2 * 1e-134 56.4 %
:RPS:PFM   58->328 PF02733 * Dak1 6e-92 60.0 %
:HMM:PFM   24->323 PF02733 * Dak1 7.4e-102 45.3 296/326  
:BLT:SWISS 2->331 DHAK_LACLA e-112 61.3 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE00435.1 GT:GENE dAK.2 GT:PRODUCT Dihydroxyacetone kinase GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION complement(1719650..1720645) GB:FROM 1719650 GB:TO 1720645 GB:DIRECTION - GB:GENE dAK GB:PRODUCT Dihydroxyacetone kinase GB:NOTE COG2376 [G] Dihydroxyacetone kinase GB:PROTEIN_ID ABE00435.1 GB:DB_XREF GI:90821796 GB:GENE:GENE dAK LENGTH 331 SQ:AASEQ MKKIINNPADVVPEMVNGMVRLYPQYIEKIDGTEVMVRSDKESMQGKVGIVSGGGSGHEPSHAGFVGKGMLSAAVAGQVFTSPTPDQIYEAIKAVDSGKGVFLVIKNYSGDVMNFDMAKDMAEMDDIEVKSIIVNDDIAVEDSLYTQGRRGVAGTVLMHKILGAAADQGASLDEIEELAKKVLPNLKTIGVALSAATVPEVGKPGFELAEDEIEYGVGIHSEPGYRREKIKPSKELVAELIEKLDEELHLDKDKKYAVLINGMGATPLMEQYVFGNDVLDALEAKGVKPVFTKAGNYMTSIEMAGISLTIFELAEDKWLEYLNYPVETIAW GT:EXON 1|1-331:0| BL:SWS:NREP 1 BL:SWS:REP 2->331|DHAK_LACLA|e-112|61.3|328/332| SEG 46->57|gkvgivsgggsg| BL:PDB:NREP 1 BL:PDB:REP 2->331|3ct4A|e-106|61.0|318/318| RP:PDB:NREP 1 RP:PDB:REP 2->331|3ct4A|e-123|62.9|318/318| RP:PFM:NREP 1 RP:PFM:REP 58->328|PF02733|6e-92|60.0|270/317|Dak1| HM:PFM:NREP 1 HM:PFM:REP 24->323|PF02733|7.4e-102|45.3|296/326|Dak1| GO:PFM:NREP 2 GO:PFM GO:0004371|"GO:glycerone kinase activity"|PF02733|IPR004006| GO:PFM GO:0006071|"GO:glycerol metabolic process"|PF02733|IPR004006| RP:SCP:NREP 1 RP:SCP:REP 1->331|1un8A4|e-104|32.0|322/335|c.119.1.2| HM:SCP:REP 10->331|1oi2A_|1e-134|56.4|319/347|c.119.1.2|1/1|DAK1/DegV-like| OP:NHOMO 700 OP:NHOMOORG 472 OP:PATTERN ----------------------------1-1------------------------------------- ---1211-----1-1----------3-------222-211----213-1221323--2----122341221---------1-1----------1-----------1------------------------------11122-------1--------------------1------------------------22222222122222222----2221---111222223-1-111111111111112111211--12-----22--11-21---2112222--2--------2------2--3---2--2-122---2222-1--111111112211---111-11-1----1-------1---211--1---------------11----------122-222-24-11111-1114--311-233552331----1------2----------1111---2-----------------------------------------11111121111121222211111---------2----1-3--1----211----------11----------1-11111--------------11-----------------------------11-----------------------------------------22--21-1111121211--111211111-111111112221---2----------------111-111---111111111111-------------1--2-1112-1--------1----------1----------------11-------------1------1--------------------1--------------1----------1--------11------------------- ----11--21---112322111111121111111111211--11111136223433222222314112-1111132212211111111-112312132221-1111-111411-1121-1111111111371-113-11-1-111-111111-1111111--11212--25211--1118111112114221111111- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 331 STR:RPRED 100.0 SQ:SECSTR HccccccGGGHHHHHHHHHHHHTTTEEEcGGGccEEEEccccccccEEEEEEEEccTcTTTTGGGcccTcccEEEEEEETccccHHHHHHHHHHHcccccEEEEEEccHHHHHHHHHHHHHHHHTTccEEEEEEcccccccccTTcccccccTTHHHHHHHHHHHHHTTccHHHHHHHHHHHHTTEEEEEEEcccccccHTcccEEEEEccEEEETccTTcccccEEEEcccHHHHHHHHHHHHHHHHTccTTcEEEEEEEEcccccHHHHHHHHHHHHHHHHTTTcEEEEEEEEcccccTTccEEEEEEEEcccHHHHHHHTcccccccc PSIPRED cccccccHHHHHHHHHHHHHHHcHHHHccccccEEEEEcccccccccEEEEEccccccccccccccccccEEEEEEccccccccHHHHHHHHHHccccccEEEEEccccccHHHHHHHHHHHHHccccEEEEEEEccEEccccccccccccccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHccEEEEEEcccccccccccccccccccEEEEEEEccccccEEcccccHHHHHHHHHHHHHHHcccccccEEEEEEcccccccHHHHHHHHHHHHHHHHHcccEEEEEEEEcccccccccccEEEEEEcccHHHHHHHccccccccc //