[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : dapA
DDBJ      :dapA         Dihydrodipicolinate synthase
Swiss-Prot:DAPA_LACS1   RecName: Full=Dihydrodipicolinate synthase;         Short=DHDPS;         EC=4.2.1.52;

Homologs  Archaea  61/68 : Bacteria  859/915 : Eukaryota  145/199 : Viruses  0/175   --->[See Alignment]
c.1.10
:290 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   8->267 1xkyA PDBj 7e-66 44.8 %
:RPS:PDB   8->277 3cprA PDBj 1e-76 36.3 %
:RPS:SCOP  8->277 1f5zA  c.1.10.1 * 7e-83 23.9 %
:HMM:SCOP  8->289 1xkyA1 c.1.10.1 * 7.4e-85 40.9 %
:RPS:PFM   8->276 PF00701 * DHDPS 2e-64 43.7 %
:HMM:PFM   7->289 PF00701 * DHDPS 1.6e-94 42.2 282/289  
:BLT:SWISS 1->277 DAPA_LACS1 e-159 100.0 %
:PROS 41->58|PS00665|DHDPS_1
:PROS 137->167|PS00666|DHDPS_2
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABD99449.1 GT:GENE dapA GT:PRODUCT Dihydrodipicolinate synthase GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION 681898..682770 GB:FROM 681898 GB:TO 682770 GB:DIRECTION + GB:GENE dapA GB:PRODUCT Dihydrodipicolinate synthase GB:NOTE COG0329 [EM] Dihydrodipicolinate synthase/N-acetylneuraminate lyase GB:PROTEIN_ID ABD99449.1 GB:DB_XREF GI:90820810 GB:GENE:GENE dapA LENGTH 290 SQ:AASEQ MNFRNAHILTAMVTPFDDEGNYSSKRTKNLINYLLDNGTEGLLVSGTTGEAPTLSEDEKLQLIKDSVKFIDGRVPLMVGTGSNNTQQTIDYTNKVADIDGVDAALVVVPYYNKPNQKGMIAHFRKVADYSNLPIIIYNIPGRTGVTMEVDTIIELAQHDNIIGIKDCTGVENIAKIVENVPEDFLVYSGEDAEALSARVLGGQGIISVASHIYGDNMKTMYSSLESGDVSMAGKIMRDLIPKAEALFSYPSPSPVKAALNKIGYNVGGCRLPIVSLDKNEENELFKKLKI GT:EXON 1|1-290:0| SW:ID DAPA_LACS1 SW:DE RecName: Full=Dihydrodipicolinate synthase; Short=DHDPS; EC=4.2.1.52; SW:GN Name=dapA; OrderedLocusNames=LSL_0639; SW:KW Amino-acid biosynthesis; Complete proteome; Cytoplasm;Diaminopimelate biosynthesis; Lyase; Lysine biosynthesis; Schiff base. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->277|DAPA_LACS1|e-159|100.0|277/290| GO:SWS:NREP 5 GO:SWS GO:0008652|"GO:cellular amino acid biosynthetic process"|Amino-acid biosynthesis| GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0019877|"GO:diaminopimelate biosynthetic process"|Diaminopimelate biosynthesis| GO:SWS GO:0016829|"GO:lyase activity"|Lyase| GO:SWS GO:0009085|"GO:lysine biosynthetic process"|Lysine biosynthesis| PROS 41->58|PS00665|DHDPS_1|PDOC00569| PROS 137->167|PS00666|DHDPS_2|PDOC00569| SEG 278->289|kneenelfkklk| BL:PDB:NREP 1 BL:PDB:REP 8->267|1xkyA|7e-66|44.8|259/292| RP:PDB:NREP 1 RP:PDB:REP 8->277|3cprA|1e-76|36.3|267/301| RP:PFM:NREP 1 RP:PFM:REP 8->276|PF00701|2e-64|43.7|268/288|DHDPS| HM:PFM:NREP 1 HM:PFM:REP 7->289|PF00701|1.6e-94|42.2|282/289|DHDPS| GO:PFM:NREP 2 GO:PFM GO:0008152|"GO:metabolic process"|PF00701|IPR002220| GO:PFM GO:0016829|"GO:lyase activity"|PF00701|IPR002220| RP:SCP:NREP 1 RP:SCP:REP 8->277|1f5zA|7e-83|23.9|268/293|c.1.10.1| HM:SCP:REP 8->289|1xkyA1|7.4e-85|40.9|281/0|c.1.10.1|1/1|Aldolase| OP:NHOMO 2207 OP:NHOMOORG 1065 OP:PATTERN 111---224444444221111111211222211111111111111111111111111-1121212--- 3251323133312122211-13112311111243433487111115211221253212--1122315654211113113221211111232211111111111122142511111111111111111111111111111111111111111111111111111111111111111111111113--221112122222222222222227244322221332421111111241222222222222222112211--11-1-1-3311121211111111111111211333333332331111111111111211111111212124111111121235111222111--1131122111111222112111214111111111119451234433122222222224-11411D12551196649B5CB966532122244133113111111112121121311-111111111111111111111111112121114542579958663332556544443573732551256421422435277121121121111111111111111111111211111211111111111113111111212211211111111111111111222211211212111111211112121122--1111111111142522314224443422-22422332222542232221434322232323233333232233222222211222222222222111111111121111324222223222222222442432212121443534352465214321----1---122211111112112112323322211111112111111----------1--------1--------1---1---1111112111111 ---------------22556655675633222233311111112223566AACB89633222115-------543--------------443222133311-1312--2-3211224211112-2215-892-425221-2-221-111-2--21222222213211--2---211111J1111232135311241122 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 277 STR:RPRED 95.5 SQ:SECSTR ccccEHEEEEEccccccTTccccHHHHHHHHHHHHHTTccEEEEccTTTTTTTccHHHHHHHHHHHHHHHTTTcEEEEEcccccHHHHHHHHHHHHHTHTccEEEEEccccccccHHHHHHHHHHHHHHccccEEEEEcHHHHcccccHHHHHHHTTcTTEEEEEccccHHHHHHHHHHHHHccEEEEccGGGHHHHHHTTccEEEEcGGGTcHHHHHHHHHHHHHTcHHHHHHHHHHTHHHHHHHHHHcHHHHHHHHHHHTTcccccccTTccccc############# DISOP:02AL 1-3| PSIPRED ccccccccEEEEcccccccccccHHHHHHHHHHHHHccccEEEEccccccHHHccHHHHHHHHHHHHHHHcccccEEEEcccccHHHHHHHHHHHHHHHcccEEEEcccccccccHHHHHHHHHHHHHcccccEEEEEccccccccccHHHHHHHHccccEEEEEccccHHHHHHHHHHccccEEEEEccHHHHHHHHHHcccEEEHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHcccccccccccccccccccHHHHHHHHcc //