[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : dedA
DDBJ      :dedA         DedA family protein
Swiss-Prot:             

Homologs  Archaea  4/68 : Bacteria  393/915 : Eukaryota  10/199 : Viruses  0/175   --->[See Alignment]
:213 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   82->168 PF09335 * SNARE_assoc 2e-08 27.6 %
:HMM:PFM   46->175 PF09335 * SNARE_assoc 4.3e-26 29.4 119/123  
:HMM:PFM   162->196 PF04956 * TrbC 0.00044 24.2 33/100  
:BLT:SWISS 3->185 DEDA_ECOLI 4e-39 42.9 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABD99248.1 GT:GENE dedA GT:PRODUCT DedA family protein GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION complement(477779..478420) GB:FROM 477779 GB:TO 478420 GB:DIRECTION - GB:GENE dedA GB:PRODUCT DedA family protein GB:NOTE COG0586 [S] Uncharacterized membrane-associated protein GB:PROTEIN_ID ABD99248.1 GB:DB_XREF GI:90820609 GB:GENE:GENE dedA LENGTH 213 SQ:AASEQ MNFLIDFILHIDAHLVNIVNSFGNLTYLIVFGVIFIETGAVIMPFLPGDSLLFAASALSASSEYHLNIWLFIILFWLASVTGDSLNYFIGHKVGRSVSQHHFFGKFIKEENMKKTEAFFEKHGGIAISLARFMPIIRTLSPFVSGGTGVKYSTFIKYNLLGATAWVLICCGAGYFFGNIPVVKEHFSLVIIGIIVVSLIPAIIGALRSKLSKN GT:EXON 1|1-213:0| BL:SWS:NREP 1 BL:SWS:REP 3->185|DEDA_ECOLI|4e-39|42.9|182/219| TM:NTM 5 TM:REGION 1->23| TM:REGION 34->56| TM:REGION 68->90| TM:REGION 159->181| TM:REGION 186->207| SEG 50->62|sllfaasalsass| SEG 68->77|iwlfiilfwl| SEG 187->204|slviigiivvslipaiig| RP:PFM:NREP 1 RP:PFM:REP 82->168|PF09335|2e-08|27.6|87/119|SNARE_assoc| HM:PFM:NREP 2 HM:PFM:REP 46->175|PF09335|4.3e-26|29.4|119/123|SNARE_assoc| HM:PFM:REP 162->196|PF04956|0.00044|24.2|33/100|TrbC| OP:NHOMO 610 OP:NHOMOORG 407 OP:PATTERN -------------------------------------------21--1-------------------1 -----11-11122121111-1111111111111111224311112----1111121-1111131212121--11111111111---11111111-----2-11--122-2---------------11122112211---------1---1--1-------------2--1--------------11----1--1---------------------------1-1-111111--1--------------------1112212111222211112222111111-----11---------------------------------1---11-----111-11-----12----------11------1-1-1----11---------------1------1-----------------------------------------------------------1--1---------------------------------------1111122222211111113111111122112111111111112111111111--1-1111111111111111-------11-1111111-11111--1--11-111-1-------1-------1-1--11211-------1-------------1------------------23311233333333333-3333333333333333332111111213332333333333323133333332-222222222222--1-1111111111-------------------2222222-----11111111-1111-111222222222-----------------------------------1111----------------------------------------------11- --------------------------------------------------------------------------------------------------------------------------------------------------------------1-----------------111D11111-------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 211-214| PSIPRED cHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHccHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc //