[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : def.1
DDBJ      :def          Peptide deformylase
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  72/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.167.1
:103 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   27->92 3fwxA PDBj 4e-05 30.3 %
:RPS:PDB   2->103 1bs4A PDBj 1e-17 26.0 %
:RPS:SCOP  10->103 1bs4A  d.167.1.1 * 4e-17 27.2 %
:HMM:SCOP  1->103 1y6hA_ d.167.1.1 * 3.1e-17 26.7 %
:HMM:PFM   7->102 PF01327 * Pep_deformylase 4.1e-16 28.1 96/157  
:BLT:SWISS 1->103 DEF_CLOB8 2e-26 52.4 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABD99176.1 GT:GENE def.1 GT:PRODUCT Peptide deformylase GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION complement(395291..395602) GB:FROM 395291 GB:TO 395602 GB:DIRECTION - GB:GENE def GB:PRODUCT Peptide deformylase GB:NOTE COG0242 [J] N-formylmethionyl-tRNA deformylase GB:PROTEIN_ID ABD99176.1 GB:DB_XREF GI:90820537 GB:GENE:GENE def LENGTH 103 SQ:AASEQ MIRDINHDVKILSKKSTPASKNDIAIVQDLVDTLNYHRDHCVGMAANMIGKNKCIIACQFGPLIVAMINPVITKKSQKYSTSEGCLSLTGERETTRFNKIEVS GT:EXON 1|1-103:0| BL:SWS:NREP 1 BL:SWS:REP 1->103|DEF_CLOB8|2e-26|52.4|103/136| BL:PDB:NREP 1 BL:PDB:REP 27->92|3fwxA|4e-05|30.3|66/162| RP:PDB:NREP 1 RP:PDB:REP 2->103|1bs4A|1e-17|26.0|100/168| HM:PFM:NREP 1 HM:PFM:REP 7->102|PF01327|4.1e-16|28.1|96/157|Pep_deformylase| RP:SCP:NREP 1 RP:SCP:REP 10->103|1bs4A|4e-17|27.2|92/168|d.167.1.1| HM:SCP:REP 1->103|1y6hA_|3.1e-17|26.7|101/0|d.167.1.1|1/1|Peptide deformylase| OP:NHOMO 76 OP:NHOMOORG 72 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------111111--22----------------------------------------------------------------------------------------------------------------------------------------------------------------------------111--111111111--111------11111111--1111111111111111111111111--1111111----1-------1-1-----11-------13-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 103 STR:RPRED 100.0 SQ:SECSTR cccccccTTGGGGccccccccHHHHHHHHHHHHHHHHHTTccEEEGGGGTccccEEEEccccccEEEEEEEEEEEEcccccEEccTTcTTccEcccccEEEEE PSIPRED cccccccccccccEEEEEccHHHHHHHHHHHHHHHHcccccEEEEcccccccEEEEEEEcccccEEEEEEEEEEEcccEEEEEEEEEcccccccccccEEEEc //