[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : def.2
DDBJ      :def          Peptide deformylase
Swiss-Prot:DEF_LACS1    RecName: Full=Peptide deformylase;         Short=PDF;         EC=3.5.1.88;AltName: Full=Polypeptide deformylase;

Homologs  Archaea  1/68 : Bacteria  764/915 : Eukaryota  30/199 : Viruses  0/175   --->[See Alignment]
d.167.1
:186 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   1->186 3g6nA PDBj 3e-61 60.9 %
:RPS:PDB   1->186 2ai7A PDBj 6e-52 55.7 %
:RPS:SCOP  1->185 1lm4A  d.167.1.1 * 1e-52 54.1 %
:HMM:SCOP  1->187 1lqyA_ d.167.1.1 * 3.8e-57 42.9 %
:RPS:PFM   7->172 PF01327 * Pep_deformylase 5e-20 45.3 %
:HMM:PFM   4->174 PF01327 * Pep_deformylase 4.4e-48 45.5 154/157  
:BLT:SWISS 1->186 DEF_LACS1 e-107 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABD99459.1 GT:GENE def.2 GT:PRODUCT Peptide deformylase GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION complement(694232..694792) GB:FROM 694232 GB:TO 694792 GB:DIRECTION - GB:GENE def GB:PRODUCT Peptide deformylase GB:NOTE COG0242 [J] N-formylmethionyl-tRNA deformylase GB:PROTEIN_ID ABD99459.1 GB:DB_XREF GI:90820820 GB:GENE:GENE def LENGTH 186 SQ:AASEQ MITMDNIIRDGNPTLRARAKAIEFPLSEEDKKLAHDMMEFLENSQNPEIAKKYHLRAGVGLAAPQVDVSKRMTAVLVPGIEDDDEPIFKHVLINPTILSESVQLAALGEGEGCLSVDRDIPGYVPRHDRIKLRWYDLDGNKHVERLRDYPAIVVQHEIDHLNGILFYDHINKEQPLTVPEGTIILE GT:EXON 1|1-186:0| SW:ID DEF_LACS1 SW:DE RecName: Full=Peptide deformylase; Short=PDF; EC=3.5.1.88;AltName: Full=Polypeptide deformylase; SW:GN Name=def; OrderedLocusNames=LSL_0649; SW:KW Complete proteome; Hydrolase; Iron; Metal-binding;Protein biosynthesis. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->186|DEF_LACS1|e-107|100.0|186/186| GO:SWS:NREP 3 GO:SWS GO:0016787|"GO:hydrolase activity"|Hydrolase| GO:SWS GO:0046872|"GO:metal ion binding"|Metal-binding| GO:SWS GO:0006412|"GO:translation"|Protein biosynthesis| BL:PDB:NREP 1 BL:PDB:REP 1->186|3g6nA|3e-61|60.9|179/183| RP:PDB:NREP 1 RP:PDB:REP 1->186|2ai7A|6e-52|55.7|183/194| RP:PFM:NREP 1 RP:PFM:REP 7->172|PF01327|5e-20|45.3|148/155|Pep_deformylase| HM:PFM:NREP 1 HM:PFM:REP 4->174|PF01327|4.4e-48|45.5|154/157|Pep_deformylase| GO:PFM:NREP 3 GO:PFM GO:0005506|"GO:iron ion binding"|PF01327|IPR000181| GO:PFM GO:0006412|"GO:translation"|PF01327|IPR000181| GO:PFM GO:0042586|"GO:peptide deformylase activity"|PF01327|IPR000181| RP:SCP:NREP 1 RP:SCP:REP 1->185|1lm4A|1e-52|54.1|183/190|d.167.1.1| HM:SCP:REP 1->187|1lqyA_|3.8e-57|42.9|184/184|d.167.1.1|1/1|Peptide deformylase| OP:NHOMO 1003 OP:NHOMOORG 795 OP:PATTERN ---------------------------------------------1---------------------- 121-1111---1-1--------------------------111--1--2111321113--11----1121-11111111-2---1211--11-1111-111111111111111111111111112111-111111111111111112222222211111112111122222121111121111111--11-1122222222222222221122122222122112111111311111111111111111111111111111111111111112111111111111111111111111111111111111111111111111111--1-1111111-1-1-22-111-111111-1111121-1-11111111--11111111111211--1111111122222221222-11111-1111211111111111111111111122221122222222222222122111222221111311112133122111111-111121111------1------12--------21112112221211121111133211111-111111122211111111111111111122222222211113311--1-1-----111111111111-11222111112111222222222333322123111-11121--111111111111111111121-111111111111111111111211212111111111111111111111111111-----------111------12222111-11111111111111122222121111112222111111121111---------1111222222121221111111111--1---2111111111-11-1-1-1----1-111-111---1111111121111111111111 11------1---111---------------------------------------------------------------------------------------------2----------------------------------------------------------11------11-29111112112-31-121111 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 186 STR:RPRED 100.0 SQ:SECSTR cccGGGcccTTcGGGGcccccccccccHHHHHHHHHHHHHHHHHHcHHHHHHTTcccccEEEGGGGTccccEEEEEEEccTccccEEEEEEEEEEEEEEEcccEEEETTccccTTccccccccccEEccEEEEEEcTTccEEEEEEcHHHHHHHHHHHHHTTTccGGGGcccccTTcccTTEEEEc PSIPRED ccccHHHHHcccHHHEEEEEEccccccHHHHHHHHHHHHHHHHcccHHHHHHccccccEEEEEccccccEEEEEEEcccccccccccccEEEEEEEEEEEcccEEEEEcccccccccccccEEEccccEEEEEEEcccccEEEEEEEccEEEEEEHHHHHcccEEEEEEccHHHHHHHHHHHcccc //