[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : dgkA
DDBJ      :dgkA         Diacylglycerol kinase
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  88/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:138 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   19->109 2kdcA PDBj 3e-05 28.9 %
:RPS:PFM   26->127 PF01219 * DAGK_prokar 1e-11 38.6 %
:HMM:PFM   25->128 PF01219 * DAGK_prokar 3.8e-35 46.6 103/104  
:BLT:SWISS 1->133 UDPK_STRMU 1e-27 45.1 %
:PROS 79->90|PS01069|DAGK_PROKAR
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABD99706.1 GT:GENE dgkA GT:PRODUCT Diacylglycerol kinase GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION complement(919162..919578) GB:FROM 919162 GB:TO 919578 GB:DIRECTION - GB:GENE dgkA GB:PRODUCT Diacylglycerol kinase GB:NOTE COG0818 [M] Diacylglycerol kinase GB:PROTEIN_ID ABD99706.1 GB:DB_XREF GI:90821067 GB:GENE:GENE dgkA LENGTH 138 SQ:AASEQ MPMVSKDKKKYVTKWKNRRFIKSLTYAIKGVQTVFNEERNFRFDVFALCMVIIGGLFFKVSIVEWLWLLLSATLVLTAEIINSAIENVVDLATDLKPNKLAKKAKDMGAAAVLIIAIFATLVAAMIFLPRIYFWILTF GT:EXON 1|1-138:0| BL:SWS:NREP 1 BL:SWS:REP 1->133|UDPK_STRMU|1e-27|45.1|133/137| PROS 79->90|PS01069|DAGK_PROKAR|PDOC00820| TM:NTM 2 TM:REGION 51->73| TM:REGION 111->133| SEG 63->79|vewlwlllsatlvltae| BL:PDB:NREP 1 BL:PDB:REP 19->109|2kdcA|3e-05|28.9|90/121| RP:PFM:NREP 1 RP:PFM:REP 26->127|PF01219|1e-11|38.6|101/104|DAGK_prokar| HM:PFM:NREP 1 HM:PFM:REP 25->128|PF01219|3.8e-35|46.6|103/104|DAGK_prokar| GO:PFM:NREP 3 GO:PFM GO:0004143|"GO:diacylglycerol kinase activity"|PF01219|IPR000829| GO:PFM GO:0008654|"GO:phospholipid biosynthetic process"|PF01219|IPR000829| GO:PFM GO:0016020|"GO:membrane"|PF01219|IPR000829| OP:NHOMO 88 OP:NHOMOORG 88 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------1-------------------------1---------------------------------------1--11-------------------1---111-1--1----------1--------1------1-----------1------------11111111111111-----1-1----1-----11--111---111111111111111111111111111111111111111111-1111-11-----------------------1---------1--------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 90 STR:RPRED 65.2 SQ:SECSTR ##################HHHHHHHTHHHHHHHHTTTTTHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHTHHHHHHHHHT#TccccccTTcHHHHHHHH############################# DISOP:02AL 1-18| PSIPRED ccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc //