[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : efp.1
DDBJ      :efp          Protein Translation Elongation Factor P
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  906/915 : Eukaryota  29/199 : Viruses  0/175   --->[See Alignment]
b.34.5b.40.4
:185 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->185 1uebA PDBj 3e-47 46.7 %
:RPS:PDB   2->125 3cpfA PDBj 3e-34 16.5 %
:RPS:SCOP  1->62 1uebA1  b.34.5.2 * 2e-21 50.0 %
:RPS:SCOP  65->126 1bkbA2  b.40.4.5 * 1e-20 22.6 %
:RPS:SCOP  129->185 1uebA3  b.40.4.5 * 1e-13 59.6 %
:HMM:SCOP  1->63 1uebA1 b.34.5.2 * 5.9e-23 66.7 %
:HMM:SCOP  65->129 1iz6A2 b.40.4.5 * 1.2e-25 53.8 %
:HMM:SCOP  128->185 1uebA3 b.40.4.5 * 2.4e-19 58.6 %
:RPS:PFM   5->60 PF08207 * EFP_N 4e-18 75.0 %
:RPS:PFM   67->116 PF01132 * EFP 2e-13 58.0 %
:RPS:PFM   129->184 PF09285 * Elong-fact-P_C 1e-15 66.1 %
:HMM:PFM   3->60 PF08207 * EFP_N 4.6e-34 72.4 58/58  
:HMM:PFM   129->184 PF09285 * Elong-fact-P_C 2.1e-28 58.9 56/56  
:HMM:PFM   67->119 PF01132 * EFP 1.2e-26 50.9 53/55  
:BLT:SWISS 1->185 EFP_ANOFW 1e-84 77.8 %
:PROS 150->169|PS01275|EFP

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABD99339.1 GT:GENE efp.1 GT:PRODUCT Protein Translation Elongation Factor P GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION 575133..575690 GB:FROM 575133 GB:TO 575690 GB:DIRECTION + GB:GENE efp GB:PRODUCT Protein Translation Elongation Factor P GB:NOTE COG0231 [J] Translation elongation factor P (EF-P); translation initiation factor 5A (eIF-5A) GB:PROTEIN_ID ABD99339.1 GB:DB_XREF GI:90820700 GB:GENE:GENE efp LENGTH 185 SQ:AASEQ MISVNEFKNGLTIEVDGELWRVVEFQHVKPGKGSAFVRSKLKNLRTGAVQEKTFRAGEKVNQAQIDRKKMQYLYADGDNYVFMDTNTYEQLELPGSQIEEELKYMKENMVVSIIMFGTETLGVELPNTVDLEVKETEPGIKGDTSSGGSKPATMETGLVVQVPFFVSEGDVLTINTSDGTYISRA GT:EXON 1|1-185:0| BL:SWS:NREP 1 BL:SWS:REP 1->185|EFP_ANOFW|1e-84|77.8|185/185| PROS 150->169|PS01275|EFP|PDOC00981| BL:PDB:NREP 1 BL:PDB:REP 1->185|1uebA|3e-47|46.7|184/184| RP:PDB:NREP 1 RP:PDB:REP 2->125|3cpfA|3e-34|16.5|121/132| RP:PFM:NREP 3 RP:PFM:REP 5->60|PF08207|4e-18|75.0|56/58|EFP_N| RP:PFM:REP 67->116|PF01132|2e-13|58.0|50/55|EFP| RP:PFM:REP 129->184|PF09285|1e-15|66.1|56/56|Elong-fact-P_C| HM:PFM:NREP 3 HM:PFM:REP 3->60|PF08207|4.6e-34|72.4|58/58|EFP_N| HM:PFM:REP 129->184|PF09285|2.1e-28|58.9|56/56|Elong-fact-P_C| HM:PFM:REP 67->119|PF01132|1.2e-26|50.9|53/55|EFP| GO:PFM:NREP 2 GO:PFM GO:0003746|"GO:translation elongation factor activity"|PF01132|IPR001059| GO:PFM GO:0006414|"GO:translational elongation"|PF01132|IPR001059| RP:SCP:NREP 3 RP:SCP:REP 1->62|1uebA1|2e-21|50.0|62/63|b.34.5.2| RP:SCP:REP 65->126|1bkbA2|1e-20|22.6|62/65|b.40.4.5| RP:SCP:REP 129->185|1uebA3|1e-13|59.6|57/58|b.40.4.5| HM:SCP:REP 1->63|1uebA1|5.9e-23|66.7|63/0|b.34.5.2|1/1|Translation proteins SH3-like domain| HM:SCP:REP 65->129|1iz6A2|1.2e-25|53.8|65/0|b.40.4.5|1/1|Nucleic acid-binding proteins| HM:SCP:REP 128->185|1uebA3|2.4e-19|58.6|58/58|b.40.4.5|1/1|Nucleic acid-binding proteins| OP:NHOMO 1138 OP:NHOMOORG 935 OP:PATTERN -------------------------------------------------------------------- 1221111111111111111-111111111111111111111111111111111111111111111111111-1111111111111111111111221--1111111211122222222222222211111111111111112221111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111121222212221111232221111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111112111111111221111111111111111111111-11111111121111111111111111111112222211111111111111111111111111111111111111111111111111111111111111211111111111111111111112111111111111111111111111111111111111111112111111111111222222222111111111111111111111111111111111111112222122212111111111111111211-1111111111122222222222222222-222222222222222122222222222222222222121222222222222112222222122221112111111111122121111111111111111111111111111111111111111111111111111122222222222222222222222222222111111111-1111111111111111-11111111111111111111111111111111 ------------111----------------------------------------------------------------------------------------1----31-----------------------------------------------------1-----------1222F-11122222-221111111 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 185 STR:RPRED 100.0 SQ:SECSTR EEEGGGccTTcEEEETTEEEEEEEEEEEcccccccEEEEEEEETTTccEEEEEEETTcEEEEEccEEEEEEEEEEETTEEEEEcccEEcccccccHHHHHHHHHHHHHcEEEEEEETTEEEEEEEEcEEEEEEEEcccccccccccccEEEEEETTccEEEEETTccTTcEEEEETTTTEEEEEc DISOP:02AL 1-1,184-186| PSIPRED cccccccccccEEEEccEEEEEEEEEEEcccccccEEEEEEEEcccccEEEEEEccccEEEEEEEEEEEEEEEEEcccEEEEEEcccccEEEEcHHHHHHHHHHcccccEEEEEEEccEEEEEEcccEEEEEEEEcccccccEEccccccEEEEEcccEEEcccccccccEEEEEcccccEEEcc //