[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : efp.2
DDBJ      :efp          Protein Translation Elongation Factor P
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  906/915 : Eukaryota  27/199 : Viruses  0/175   --->[See Alignment]
b.34.5b.40.4
:185 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->185 1uebA PDBj 4e-35 38.0 %
:RPS:PDB   2->125 3cpfA PDBj 2e-24 12.4 %
:RPS:SCOP  1->61 1uebA1  b.34.5.2 * 2e-15 32.8 %
:RPS:SCOP  65->127 1uebA2  b.40.4.5 * 1e-17 32.3 %
:RPS:SCOP  129->185 1uebA3  b.40.4.5 * 1e-12 50.9 %
:HMM:SCOP  1->63 1uebA1 b.34.5.2 * 5.2e-18 46.0 %
:HMM:SCOP  65->129 1iz6A2 b.40.4.5 * 1.6e-22 53.8 %
:HMM:SCOP  128->185 1uebA3 b.40.4.5 * 1.7e-18 55.2 %
:RPS:PFM   3->60 PF08207 * EFP_N 6e-09 43.1 %
:RPS:PFM   67->115 PF01132 * EFP 2e-07 46.9 %
:RPS:PFM   129->184 PF09285 * Elong-fact-P_C 4e-12 60.7 %
:HMM:PFM   129->184 PF09285 * Elong-fact-P_C 1.2e-26 57.1 56/56  
:HMM:PFM   4->60 PF08207 * EFP_N 4e-23 43.9 57/58  
:HMM:PFM   67->121 PF01132 * EFP 3.3e-21 47.3 55/55  
:BLT:SWISS 1->185 EFP1_LACAC 5e-71 69.2 %
:PROS 150->169|PS01275|EFP

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE00503.1 GT:GENE efp.2 GT:PRODUCT Protein Translation Elongation Factor P GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION complement(1783118..1783675) GB:FROM 1783118 GB:TO 1783675 GB:DIRECTION - GB:GENE efp GB:PRODUCT Protein Translation Elongation Factor P GB:NOTE COG0231 [J] Translation elongation factor P (EF-P); translation initiation factor 5A (eIF-5A) GB:PROTEIN_ID ABE00503.1 GB:DB_XREF GI:90821864 GB:GENE:GENE efp LENGTH 185 SQ:AASEQ MVEAINLKKGMIFEMNGKLIKVLEANHHKPGKGNTVMQMKLNDVRTGAIVQTTMRPSEKVELAIVDKKNAQYLYGEGDLEVFMDMDTYEQYELTKEQLANEEKYLMPNMEVQLDFCKNELIGIELPTTVEMKVTETEPTIKGATAASGGKPATMETGLVVTVPDFINVGDTLVINTTTGEYKARA GT:EXON 1|1-185:0| BL:SWS:NREP 1 BL:SWS:REP 1->185|EFP1_LACAC|5e-71|69.2|185/191| PROS 150->169|PS01275|EFP|PDOC00981| BL:PDB:NREP 1 BL:PDB:REP 1->185|1uebA|4e-35|38.0|184/184| RP:PDB:NREP 1 RP:PDB:REP 2->125|3cpfA|2e-24|12.4|121/132| RP:PFM:NREP 3 RP:PFM:REP 3->60|PF08207|6e-09|43.1|58/58|EFP_N| RP:PFM:REP 67->115|PF01132|2e-07|46.9|49/55|EFP| RP:PFM:REP 129->184|PF09285|4e-12|60.7|56/56|Elong-fact-P_C| HM:PFM:NREP 3 HM:PFM:REP 129->184|PF09285|1.2e-26|57.1|56/56|Elong-fact-P_C| HM:PFM:REP 4->60|PF08207|4e-23|43.9|57/58|EFP_N| HM:PFM:REP 67->121|PF01132|3.3e-21|47.3|55/55|EFP| GO:PFM:NREP 2 GO:PFM GO:0003746|"GO:translation elongation factor activity"|PF01132|IPR001059| GO:PFM GO:0006414|"GO:translational elongation"|PF01132|IPR001059| RP:SCP:NREP 3 RP:SCP:REP 1->61|1uebA1|2e-15|32.8|61/63|b.34.5.2| RP:SCP:REP 65->127|1uebA2|1e-17|32.3|62/63|b.40.4.5| RP:SCP:REP 129->185|1uebA3|1e-12|50.9|57/58|b.40.4.5| HM:SCP:REP 1->63|1uebA1|5.2e-18|46.0|63/0|b.34.5.2|1/1|Translation proteins SH3-like domain| HM:SCP:REP 65->129|1iz6A2|1.6e-22|53.8|65/0|b.40.4.5|1/1|Nucleic acid-binding proteins| HM:SCP:REP 128->185|1uebA3|1.7e-18|55.2|58/58|b.40.4.5|1/1|Nucleic acid-binding proteins| OP:NHOMO 1137 OP:NHOMOORG 933 OP:PATTERN -------------------------------------------------------------------- 1221111111111111111-111111111111111111111111111111111111111111111111111-1111111111111111111111221--1111111211122222222222222211111111111111112221111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111121222212221111232221111111111111111111111111111111111111111121111111111111111111111111111111111111111111111111111111111112111111111221111111111111111111111-11111111121111111111111111111112222211111111111111111111111111111111111111111111111111111111111111211111111111111111111112111111111111111111111111111111111111111112111111111111222222222111111111111111111111111111111111111112222122212111111111111111211-1111111111122222222222222222-222222222222222122222222222222222222121222222222222112222222122221112111111111122121111111111111111111111111111111111111111111111111111122222222222222222222222222222111111111-1111111111111111-11111111111111111111111111111111 ------------111----------------------------------------------------------------------------------------1----3------------------------------------------------------------------1222F-11122222-221111111 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 185 STR:RPRED 100.0 SQ:SECSTR EEEGGGccTTcEEEETTEEEEEEEEEEEccccEcEEEEEEEEETTTccEEEEEEETTcEEEEEccEEEEEEEEEEETTEEEEEcTcEEcccccccHHHHHHHHHHHHHcEEEEEEETTEEEEEEEEcEEEEEEEEcccccccccccccEEEEEETTccEEEEETTccTTcEEEEETTTTEEEEEc DISOP:02AL 1-1,184-186| PSIPRED ccEEcccccccEEEEccEEEEEEEEEEEcccccccEEEEEEEEcccccEEEEEEccccEEEEEEEEEEEEEEEEEcccEEEEEEcccccEEEEcHHHHHHHHHHcccccEEEEEEEccEEEEEEcccEEEEEEEEcccccccEEccccccEEEEEcccEEEcccccccccEEEEEcccccEEEcc //