[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : fabG.2
DDBJ      :fabG         3-oxoacyl-[acyl-carrier protein] reductase
Swiss-Prot:             

Homologs  Archaea  50/68 : Bacteria  874/915 : Eukaryota  187/199 : Viruses  0/175   --->[See Alignment]
c.2.1
:241 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   4->238 2p68A PDBj 1e-31 31.2 %
:RPS:PDB   2->234 1a27A PDBj 6e-31 18.1 %
:RPS:SCOP  4->239 1pwxA  c.2.1.2 * 3e-34 18.2 %
:HMM:SCOP  1->238 1zemA1 c.2.1.2 * 5.2e-52 32.8 %
:RPS:PFM   2->166 PF00106 * adh_short 8e-13 32.1 %
:HMM:PFM   3->166 PF00106 * adh_short 5.6e-21 24.7 158/167  
:HMM:PFM   144->235 PF08323 * Glyco_transf_5 0.00022 22.0 91/241  
:BLT:SWISS 4->239 YMFI_BACSU 2e-47 41.3 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABD99941.1 GT:GENE fabG.2 GT:PRODUCT 3-oxoacyl-[acyl-carrier protein] reductase GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION complement(1164690..1165415) GB:FROM 1164690 GB:TO 1165415 GB:DIRECTION - GB:GENE fabG GB:PRODUCT 3-oxoacyl-[acyl-carrier protein] reductase GB:NOTE COG1028 [IQR] Dehydrogenases with different specificities (related to short-chain alcohol dehydrogenases) GB:PROTEIN_ID ABD99941.1 GB:DB_XREF GI:90821302 GB:GENE:GENE fabG LENGTH 241 SQ:AASEQ MRWALILGASGDIGSKIANDLAAQGWSLYLHYNNSYEKVKRLYDKLDSEYSKQEFLIMQSDMSKISEIDKLTNSVFSLDAVIFAEGTTKYGLFNQLKMEEFDEMLTMQLRYPLFLLQKLEEKLARSSLGRIVFIGSVYGGYGSAMEVGYSTIKGALSAFVKAYSKEIASLGITVNVVAPGAVDTRMNNMFSSDVKEQVAEDIPMGKLAQPDQISYWVTCLLADRAEYLTGQTIYVTGGWLQ GT:EXON 1|1-241:0| BL:SWS:NREP 1 BL:SWS:REP 4->239|YMFI_BACSU|2e-47|41.3|235/242| BL:PDB:NREP 1 BL:PDB:REP 4->238|2p68A|1e-31|31.2|234/248| RP:PDB:NREP 1 RP:PDB:REP 2->234|1a27A|6e-31|18.1|232/285| RP:PFM:NREP 1 RP:PFM:REP 2->166|PF00106|8e-13|32.1|162/169|adh_short| HM:PFM:NREP 2 HM:PFM:REP 3->166|PF00106|5.6e-21|24.7|158/167|adh_short| HM:PFM:REP 144->235|PF08323|0.00022|22.0|91/241|Glyco_transf_5| GO:PFM:NREP 2 GO:PFM GO:0008152|"GO:metabolic process"|PF00106|IPR002198| GO:PFM GO:0016491|"GO:oxidoreductase activity"|PF00106|IPR002198| RP:SCP:NREP 1 RP:SCP:REP 4->239|1pwxA|3e-34|18.2|231/252|c.2.1.2| HM:SCP:REP 1->238|1zemA1|5.2e-52|32.8|235/0|c.2.1.2|1/1|NAD(P)-binding Rossmann-fold domains| OP:NHOMO 7641 OP:NHOMOORG 1111 OP:PATTERN 212123354343334217-321114--51123-1---------11-21--211-221111226231-2 BAH1I--3228121BLE77-7G11Dh767778IQTRELgZ4G5X9B531861F8D41411A9D2A8BHHB611111121124H11222434415221--33H39AR6H4811111111111111343243232472A77982228637874341122111332142986E411121213221377478541A6FDDEDEFEGADEEGHDHBHHDIDDF8DDEFD7766676AM7555554355555547AA7A425267251213544684557A7534545122232211111112111354443434444421111111142356A55544434454466235433311553215411221423224353282COAA911111C6dJL476HDEGB879776A899F-DEFFEUCCHTJ1XRREHGQZWQPNHN997A7GE5AD97C77777777EHE956571131111111112233122122212111267IK72ASPJOWOSPQP7EDEEMMVXEDFD7CaEbDYPI56EEBB7D77JBJ6QQ7743646731221111344C845A34311111422113633922646557AD3223322332232222222222113216677758A94G7245555597544374464571-223361111119CDB2E58BB9888899-B89A898898B78668769ILID93787456767667566666H776886821766666666666111513121989935FF91114251111113529ACBA4B234B7GGCE9DDN77BFB8GEF5443344342334C656659958988CAC9787944442222997666--------1-2----------1--------------3231144464271 1111438-3111145CKCFFAG9NGMI46456656529686994548759GHSQ5C988A7A444-1215--62311-12265675-8-CL9K3H44332123877-4A3U6466523-1-15233-419I7-4442211444731321243152345ANKC4FDD654635E993451M121334B5DBJ454A4235 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 241 STR:RPRED 100.0 SQ:SECSTR TEEEEEcccccHHHHHHHHHHHTcTTccEEEEEEEHccGGGTHHHHHHHHHTTcEEEEEccTTcHHHHHHHHHTcTTccEEEEcccccccccGGGccHHHHHHHHHHHTHHHHHHHHHHHHHHHHHTcEEEEEEEEGGGTcccTTcHHHHHHHHHHHHHHHHHHHHHGGGTEEEEEEEEccccccTTTTccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHcccEEEcccTTHEcTTGTc PSIPRED cEEEEEEccccHHHHHHHHHHHHcccEEEEEccccHHHHHHHHHHHHHcccccEEEEEEcccccHHHHHHHHHHHccccEEEEcccccccccHHHccHHHHHHHHHHHcHHHHHHHHHHHHHHHHccccEEEEEccHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHcccEEEEEccccccccHHHcccHHHHHHHHHcccccccccHHHHHHHHHHHHcHHHccccccEEEEcccEEc //