[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : fabI
DDBJ      :fabI         Enoyl-[acyl-carrier protein] reductase (NADH)
Swiss-Prot:             

Homologs  Archaea  10/68 : Bacteria  665/915 : Eukaryota  64/199 : Viruses  0/175   --->[See Alignment]
c.2.1
:252 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   3->252 2qioA PDBj 6e-67 47.6 %
:RPS:PDB   2->251 1dohB PDBj 5e-24 21.3 %
:RPS:SCOP  4->251 1c14A  c.2.1.2 * 8e-31 49.6 %
:HMM:SCOP  6->251 1uh5A_ c.2.1.2 * 6.4e-54 28.7 %
:RPS:PFM   94->215 PF12241 * Enoyl_reductase 3e-06 35.4 %
:HMM:PFM   29->175 PF00106 * adh_short 3.8e-08 19.1 141/167  
:BLT:SWISS 1->251 FABI_BACSU 1e-68 51.8 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABD99271.1 GT:GENE fabI GT:PRODUCT Enoyl-[acyl-carrier protein] reductase (NADH) GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION 507759..508517 GB:FROM 507759 GB:TO 508517 GB:DIRECTION + GB:GENE fabI GB:PRODUCT Enoyl-[acyl-carrier protein] reductase (NADH) GB:NOTE COG0623 [I] Enoyl-[acyl-carrier-protein] reductase (NADH) GB:PROTEIN_ID ABD99271.1 GB:DB_XREF GI:90820632 GB:GENE:GENE fabI LENGTH 252 SQ:AASEQ MSDLLKGKKILVMGVANKRSIAWGCSQMMMENGAELIFTYQNDRIKKSLSRLVSEEEKLVECDVSDDASIENAFKLVNERFGKVDGILHAIAFANKEELGGEIMQASREGYALAQDISAYSLIAVAKYGREILNDPSSIVTLTYFGSERAIPNYNVMGVAKASLEASVRYLARDMAKYGTRVNAISAGAIKTLAVTGIKGHSELLKMSEERTVDGESVTIREVGGTCAFLMSDLSIGVVGDVIYVDKGVHLI GT:EXON 1|1-252:0| BL:SWS:NREP 1 BL:SWS:REP 1->251|FABI_BACSU|1e-68|51.8|251/258| BL:PDB:NREP 1 BL:PDB:REP 3->252|2qioA|6e-67|47.6|250/256| RP:PDB:NREP 1 RP:PDB:REP 2->251|1dohB|5e-24|21.3|244/271| RP:PFM:NREP 1 RP:PFM:REP 94->215|PF12241|3e-06|35.4|113/237|Enoyl_reductase| HM:PFM:NREP 1 HM:PFM:REP 29->175|PF00106|3.8e-08|19.1|141/167|adh_short| RP:SCP:NREP 1 RP:SCP:REP 4->251|1c14A|8e-31|49.6|248/256|c.2.1.2| HM:SCP:REP 6->251|1uh5A_|6.4e-54|28.7|244/0|c.2.1.2|1/1|NAD(P)-binding Rossmann-fold domains| OP:NHOMO 1182 OP:NHOMOORG 739 OP:PATTERN -----1-1-------1-1-1---1-----1-1------------------------1-----1----- 12312-----1---11111-111121111111322212332112-1-1111-11------11112124212---------1-3112221111-1--1--2221435121211111111111111111123211331111111111112121111111111111111122211112211112111112211-31311111111111111123222311122342212222222-111111111111111222111-11--11-1-1111--1111--111--------------------------------------------1--------------2-----1---1--12-----------11-------1-3122122222344342133343322222222223-24522422323244423246542443122333434432411111111211112321111111111111111111111111111112322122222111-11-33332215333313113235211111222222321421131-11211111111111122-1--21111111111111211111111111--211212222212222222221222233--1-1-----------1-1----1--1---1-1121111111111121111111111111-11111111111121111122221111132222222222222222112111111122222212222111------22221211-22211111111111111111111112-2212-13-2--1-32121111111111-112------1-----------------111-11---------------------------------------------1-111112 11------1-----1-1---2-14-4---------------------1--22-311---211--------------11-----------1-111-1-------212--1-7----1------------------------------------------2----22-2131-12-11211H111213577-512111111 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 252 STR:RPRED 100.0 SQ:SECSTR cGGccTTcEEEETTTTcHHHHHHHHHHHHHHTTcEEEEEEcccHHHHHHHHHTTccEEEEEccTTcHHHHHHHHHHHHHHHccccEEEEccccccTTcccccGGGccHHHHHHHHHHHTHHHHHHHHHHHHccTTcEEEEEccGGGTcccccccHHHHHHHHHHHHHHHHHHHHHGGGTcEEEEEEEcccccHHHHHHGGGGcTTcTTccHHHHHHHHHHHHHHHHHHHHHcGGGTTccccEEEEccccccc DISOP:02AL 1-1| PSIPRED ccccccccEEEEEcccccccHHHHHHHHHHHcccEEEEEEccHHHHHHHHHHHccccEEEEcccccHHHHHHHHHHHHHHHccccEEEEcccccccccccccHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEEEccccccccccHHHHHHHHHHHHHHHHHHHHHHHHccEEEEEcccccccHHHHHccccHHHHHHHHHcccccccccHHHHHHHHHHHHcHHHccccccEEEEccccccc //