[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : fmt
DDBJ      :fmt          Methionyl-tRNA formyltransferase
Swiss-Prot:FMT_LACS1    RecName: Full=Methionyl-tRNA formyltransferase;         EC=2.1.2.9;

Homologs  Archaea  2/68 : Bacteria  899/915 : Eukaryota  175/199 : Viruses  0/175   --->[See Alignment]
b.46.1c.65.1
:318 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   4->314 2fmtA PDBj 4e-61 37.9 %
:RPS:PDB   3->300 2cfiA PDBj 1e-65 21.3 %
:RPS:SCOP  49->202 1zghA2  c.65.1.1 * 1e-36 22.9 %
:RPS:SCOP  205->314 1fmtA1  b.46.1.1 * 5e-22 26.9 %
:HMM:SCOP  2->207 2blnA2 c.65.1.1 * 7.5e-64 37.9 %
:HMM:SCOP  205->310 1fmtA1 b.46.1.1 * 5e-21 36.5 %
:RPS:PFM   27->181 PF00551 * Formyl_trans_N 2e-27 36.2 %
:RPS:PFM   205->302 PF02911 * Formyl_trans_C 4e-11 39.6 %
:HMM:PFM   3->180 PF00551 * Formyl_trans_N 4e-43 29.7 175/181  
:HMM:PFM   204->303 PF02911 * Formyl_trans_C 4.9e-23 39.8 98/100  
:BLT:SWISS 1->318 FMT_LACS1 0.0 100.0 %
:PROS 133->156|PS00373|GART

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABD99424.1 GT:GENE fmt GT:PRODUCT Methionyl-tRNA formyltransferase GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION 656210..657166 GB:FROM 656210 GB:TO 657166 GB:DIRECTION + GB:GENE fmt GB:PRODUCT Methionyl-tRNA formyltransferase GB:NOTE COG0223 [J] Methionyl-tRNA formyltransferase GB:PROTEIN_ID ABD99424.1 GB:DB_XREF GI:90820785 GB:GENE:GENE fmt LENGTH 318 SQ:AASEQ MTNIVFMGTPAFAAPILEGIIENGYNVLAVVTQPDRPVGRKRVLHASPVKEVALKYGIKVFQPVKLSGSDEMQEIIDLQPDLIVTAAYGQFLPTKLIESVKIAAINVHGSLLPKYRGGAPVQYSIMNGDDKTGVTIIYMVKKMDAGDMLAQAELKIESTDDTGTIFEKMSILGRDVLLETLPKIISGNVEAVKQDENKVVFSPNIKPEEEILHLNLEAKEIDWKTRALRPAPGAYFKNFKGKRTKLWSIKPLEEKTEFAPGYVVNVDKHELKVSAYNGTVYSIIELQPAGKQKMDITSYLNGVGQGLKIGQRIIEDEE GT:EXON 1|1-318:0| SW:ID FMT_LACS1 SW:DE RecName: Full=Methionyl-tRNA formyltransferase; EC=2.1.2.9; SW:GN Name=fmt; OrderedLocusNames=LSL_0614; SW:KW Complete proteome; Methyltransferase; Protein biosynthesis;Transferase. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->318|FMT_LACS1|0.0|100.0|318/318| GO:SWS:NREP 3 GO:SWS GO:0008168|"GO:methyltransferase activity"|Methyltransferase| GO:SWS GO:0006412|"GO:translation"|Protein biosynthesis| GO:SWS GO:0016740|"GO:transferase activity"|Transferase| PROS 133->156|PS00373|GART|PDOC00319| BL:PDB:NREP 1 BL:PDB:REP 4->314|2fmtA|4e-61|37.9|309/314| RP:PDB:NREP 1 RP:PDB:REP 3->300|2cfiA|1e-65|21.3|291/310| RP:PFM:NREP 2 RP:PFM:REP 27->181|PF00551|2e-27|36.2|152/179|Formyl_trans_N| RP:PFM:REP 205->302|PF02911|4e-11|39.6|96/100|Formyl_trans_C| HM:PFM:NREP 2 HM:PFM:REP 3->180|PF00551|4e-43|29.7|175/181|Formyl_trans_N| HM:PFM:REP 204->303|PF02911|4.9e-23|39.8|98/100|Formyl_trans_C| GO:PFM:NREP 4 GO:PFM GO:0009058|"GO:biosynthetic process"|PF00551|IPR002376| GO:PFM GO:0016742|"GO:hydroxymethyl-, formyl- and related transferase activity"|PF00551|IPR002376| GO:PFM GO:0009058|"GO:biosynthetic process"|PF02911|IPR005793| GO:PFM GO:0016742|"GO:hydroxymethyl-, formyl- and related transferase activity"|PF02911|IPR005793| RP:SCP:NREP 2 RP:SCP:REP 49->202|1zghA2|1e-36|22.9|144/164|c.65.1.1| RP:SCP:REP 205->314|1fmtA1|5e-22|26.9|108/108|b.46.1.1| HM:SCP:REP 2->207|2blnA2|7.5e-64|37.9|203/0|c.65.1.1|1/1|Formyltransferase| HM:SCP:REP 205->310|1fmtA1|5e-21|36.5|104/108|b.46.1.1|1/1|FMT C-terminal domain-like| OP:NHOMO 1575 OP:NHOMOORG 1076 OP:PATTERN ---------------------------------------------1-----1---------------- 1111121111121231122-21221222222112222333222211121112111212221211223122211111111111111211211111111--11323111123111111111111111111112111111111111111-1111111111111111111111112112222121111111111111122222213222211221111122112111121111113311111111111111112222211111111111111111111111111111111111111111111111111111111111111111111112111111112211111111121211111111111111112111111121111111111111111221121111122222222221-22222223111211121121113211221111111111111111111111111111111111111111111111111111111111111111411333333333333333233333333222223222111111111111121111211111111211111131113111222211222231222111112111211111111411111111111111113313331111231111122111121211321-1211111111122322232222222222-222222222222222222222222342212222222222222132121122223333333333331132222221111122211111111111121111112122222212222122421111223311111111111112222222112222211111112222111111111111111111111----1-111-111---1111111111121111111121 11--12----1-111111111-1111-11-1111-1111111111111112-1--1--111111111111111111111111111111--1111111111--1111-1114233331221223132162AH3-436111132243-32213125122232142322-32221141122171121111111111121111 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 314 STR:RPRED 98.7 SQ:SECSTR cEEEEEEccHHHHHHHHHHHHHTTcEEEEEEEcccccccccHHHcccHHHHHHHHHTccEEEccccEETTEHHHHHHTcccEEEEccccccccHHHHTccTTcEEEEEcccTTTTccccHHHHHHHTTccEEEEEEEEcccccccccEEEEEEEEccTTccHHHHHHHTTHHHHHHHHHHHHHHHTTcccccccccTTccccccccGGGGcccccccHHHHHHHHHTTTTTTcEEEEEETTEEEEEEEEEcccTTcccEEEccTTEETTEEEEEcTTccEEEEEEEEcTTccEEEGGGTTHHHGGTccTTcccc#### DISOP:02AL 315-319| PSIPRED cEEEEEEcccHHHHHHHHHHHHccccEEEEEEcccccccccccccccHHHHHHHHccccEEcccccccHHHHHHHHHccccEEEEccccHHccHHHHHcccccEEEEcccccccccccHHHHHHHHccccEEEEEEEEEEcccccccEEEEEEEEccccccHHHHHHHHHHHHHHHHHHHHHHHHcccccEEEcccccccccccccHHHHHccccccHHHHHHHHccccccccEEEEEEcccEEEEEEEEEEcccccccccEEEEEcccEEEEEEccccEEEEEEEEccccccccHHHHHHccccccccccccccccc //