[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : frdA
DDBJ      :frdA         Fumarate reductase flavoprotein subunit
Swiss-Prot:             

Homologs  Archaea  48/68 : Bacteria  685/915 : Eukaryota  174/199 : Viruses  0/175   --->[See Alignment]
c.3.1
:461 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   15->55 1jehA PDBj 6e-06 46.3 %
:BLT:PDB   41->457 1q9iA PDBj 5e-70 36.0 %
:RPS:PDB   18->457 1d4cB PDBj 1e-64 39.4 %
:RPS:SCOP  18->303 1d4cA2  c.3.1.4 * 6e-35 35.4 %
:RPS:SCOP  400->457 1e7pA2  c.3.1.4 * 3e-04 27.6 %
:HMM:SCOP  1->459 1jnrA2 c.3.1.4 * 4.3e-66 33.9 %
:RPS:PFM   20->443 PF00890 * FAD_binding_2 3e-51 41.8 %
:HMM:PFM   20->443 PF00890 * FAD_binding_2 1.7e-100 42.0 393/421  
:BLT:SWISS 10->457 FRD2_SHEFN 2e-69 33.9 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE00131.1 GT:GENE frdA GT:PRODUCT Fumarate reductase flavoprotein subunit GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION complement(1374693..1376078) GB:FROM 1374693 GB:TO 1376078 GB:DIRECTION - GB:GENE frdA GB:PRODUCT Fumarate reductase flavoprotein subunit GB:NOTE COG1053 [C] Succinate dehydrogenase/fumarate reductase, flavoprotein subunit GB:PROTEIN_ID ABE00131.1 GB:DB_XREF GI:90821492 GB:GENE:GENE frdA LENGTH 461 SQ:AASEQ MAEKFIFEPWDISKLQSSYDVVIVGSGSTGLTAAIQAHELGLKPVVLEKMEKFGGNTNRASSGMNAAETNIQLHHGIVDNMDDFYKETYKGGGKLNDPELLKYFTSHSALAIDWLKDHGIELDELTFTGGMSKMRTHRPSSMAPIGAFLIKNLLKIAQDEELPVFNNVTVTKVNKENGRVNGVTVKTSEGEKVINAKTVLLATGGFGAAQDIIKKYRPDLASYKTTNHPGATGDGIKLAEELGAQVVQMNLIQVHPTVQQDTPHAFLIGEAVRGEGGILVNGEGQRFVNELNTRKVVSNAITALPEHSAYLIFDKDIRSRVKAIEFYDSIGLVEHGSDLKELAEKINVPADKLEATVNNWNQMVAAGKDTDFDRKTGMERKISEAPYYAIHIAPAIHYTMGGIHIDSRTRVIDGNGDIIPGLLAAGEVAGGLHGNNRIGGNSIAETVIFGIQAGREAFLEK GT:EXON 1|1-461:0| BL:SWS:NREP 1 BL:SWS:REP 10->457|FRD2_SHEFN|2e-69|33.9|445/588| SEG 166->175|nnvtvtkvnk| SEG 385->398|apyyaihiapaihy| SEG 421->434|gllaagevagglhg| BL:PDB:NREP 2 BL:PDB:REP 15->55|1jehA|6e-06|46.3|41/478| BL:PDB:REP 41->457|1q9iA|5e-70|36.0|414/568| RP:PDB:NREP 1 RP:PDB:REP 18->457|1d4cB|1e-64|39.4|437/566| RP:PFM:NREP 1 RP:PFM:REP 20->443|PF00890|3e-51|41.8|366/375|FAD_binding_2| HM:PFM:NREP 1 HM:PFM:REP 20->443|PF00890|1.7e-100|42.0|393/421|FAD_binding_2| GO:PFM:NREP 2 GO:PFM GO:0009055|"GO:electron carrier activity"|PF00890|IPR003953| GO:PFM GO:0016491|"GO:oxidoreductase activity"|PF00890|IPR003953| RP:SCP:NREP 2 RP:SCP:REP 18->303|1d4cA2|6e-35|35.4|285/322|c.3.1.4| RP:SCP:REP 400->457|1e7pA2|3e-04|27.6|53/336|c.3.1.4| HM:SCP:REP 1->459|1jnrA2|4.3e-66|33.9|304/357|c.3.1.4|1/1|FAD/NAD(P)-binding domain| OP:NHOMO 1739 OP:NHOMOORG 907 OP:PATTERN ---1--2122222221-2---1-1322311211111111111111111-----111111111--1--- -2113-1-223---57755-58115754555577777A782114121-211-211212--436-12333211----11-6LA222222111--111-----1---1-111---------------222223222311111111-31222322222111111112222222311-12111111131-12111-111111111111111111111111111212--121112111----------------11--12-211214125611-1-2111-111--------11-------------------------21---11122B6131111111-11111111112412--1112EA1121122----1-2-121111111111124231-21111111111111111-1111131-312-322322222221343112111112-1211111111122--3-111------11111111111111111----11651-3553-1112111111111131111112112524111123-1--121122112222122222222212222212-11111--1111-32264111122221125-471-1111---1-------3443311223111-113242331-5733253772784---1222------11221221221111111-211111111121122122222243221111111111111111121111111--1111111111111-11111111111212-11111111111-1111------1---1122121231124231111-11111111111111111121211111111111121-1113-111111----------------------------------------------111 ----113-A54-2322222344343432211112221212222211221133571221133313322214332234424324444412-14221211111122435--132211111111-12-12--11A1-121111-111---1---1--1-21111212311231176321-234o5441121212111122221 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 456 STR:RPRED 98.9 SQ:SECSTR #ccccccTcccccccccEccEEEEcccHHHHHHHHHHHHHTccEEEEcccccccTTGGGccccEEccccHHHHHTTccccHHHHHHHHHHHTTTcccHHHHHHHHHHHHHHHHHHHHTTccccEEEccTTcccccEEEccccccHHHHHHHHHHHHHHHTTcEEEcEEEEEEEEcccccEEEEEEEETTTEEEEEccEEEEcccccTTcHHHHHHHcGGGTTcEEcccTTcccHHHHHHHTTTccEEcTTcEEEEEEEEEcTTTcccccTHHHHTTcEEEcccccccccTTccHHHHHHHHHTcTTccEEEEEEHHHHHHcTHHHHHHHTTccEEEccHHHHHHHHTccHHHHHHHHHHHHHHHHHTcccccccccccccccccccEEEEEEEEEEEEEccEEEccTTcEEETTTccEEEEEEEccTTEEcccTTcccTTHHHHHHHHHHHHHHHHH#### DISOP:02AL 1-2,6-6,458-462| PSIPRED ccccccccccccHHHcccccEEEEcccHHHHHHHHHHHHccccEEEEEcccccccccccccccccccccccHHHHcccccHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHccccccccccccccccccEEccccccccHHHHHHHHHHHHHHcccEEEccEEEEEEEccccEEEEEEEEEccccEEEEEEEEEEcccccccHHHHHHHHccccccccccccccccHHHHHHHHHccccEEcccEEEEEEEEEccccccEEEEEcccccEEEEEcccccccccccccHHHHHHHHHHcccccEEEEEcHHHHHHHcccccccccccccccccHHHHHHHHcccHHHHHHHHHHHHHHHHHccccccccccccccccccccEEEEEEcHHHHcccccEEEccccEEEcccccccccEEcccHHccccccccHHHHHHHHHHHHHHHHHHHHHHHcc //