[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : frr
DDBJ      :frr          Ribosome Recycling Factor, RRF
Swiss-Prot:RRF_LACS1    RecName: Full=Ribosome-recycling factor;         Short=RRF;AltName: Full=Ribosome-releasing factor;

Homologs  Archaea  0/68 : Bacteria  907/915 : Eukaryota  91/199 : Viruses  0/175   --->[See Alignment]
d.67.3
:187 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   6->186 1dd5A PDBj 2e-48 47.5 %
:RPS:PDB   5->186 1dd5A PDBj 2e-58 47.3 %
:RPS:SCOP  5->186 1dd5A  d.67.3.1 * 6e-59 47.3 %
:HMM:SCOP  2->186 1eh1A_ d.67.3.1 * 1.1e-64 58.4 %
:RPS:PFM   21->185 PF01765 * RRF 1e-43 60.6 %
:HMM:PFM   22->185 PF01765 * RRF 1.8e-68 57.3 164/165  
:BLT:SWISS 1->187 RRF_LACS1 e-102 100.0 %
:COIL

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABD99371.1 GT:GENE frr GT:PRODUCT Ribosome Recycling Factor, RRF GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION 600955..601518 GB:FROM 600955 GB:TO 601518 GB:DIRECTION + GB:GENE frr GB:PRODUCT Ribosome Recycling Factor, RRF GB:NOTE COG0233 [J] Ribosome recycling factor GB:PROTEIN_ID ABD99371.1 GB:DB_XREF GI:90820732 GB:GENE:GENE frr LENGTH 187 SQ:AASEQ MKITEPIIKEAQEKMTKAEDSLRRELGNIRAGRANASLLNRINVEYYGAPTPLNQMAQISVPEARVLLVTPYDKTSLKNIEHAIMASDLGIAPMNDGTAIRLVIPQLTEERRKELAKQVKAVSETGKVAVRNIRRDMMDALKKAQKNGDLTEDDLRDLENQAQKVTDESIKNIDKITEDKEKEVLEG GT:EXON 1|1-187:0| SW:ID RRF_LACS1 SW:DE RecName: Full=Ribosome-recycling factor; Short=RRF;AltName: Full=Ribosome-releasing factor; SW:GN Name=frr; OrderedLocusNames=LSL_0562; SW:KW Complete proteome; Cytoplasm; Protein biosynthesis. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->187|RRF_LACS1|e-102|100.0|187/187| GO:SWS:NREP 2 GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0006412|"GO:translation"|Protein biosynthesis| COIL:NAA 29 COIL:NSEG 1 COIL:REGION 144->172| BL:PDB:NREP 1 BL:PDB:REP 6->186|1dd5A|2e-48|47.5|181/184| RP:PDB:NREP 1 RP:PDB:REP 5->186|1dd5A|2e-58|47.3|182/184| RP:PFM:NREP 1 RP:PFM:REP 21->185|PF01765|1e-43|60.6|165/165|RRF| HM:PFM:NREP 1 HM:PFM:REP 22->185|PF01765|1.8e-68|57.3|164/165|RRF| GO:PFM:NREP 1 GO:PFM GO:0006412|"GO:translation"|PF01765|IPR002661| RP:SCP:NREP 1 RP:SCP:REP 5->186|1dd5A|6e-59|47.3|182/184|d.67.3.1| HM:SCP:REP 2->186|1eh1A_|1.1e-64|58.4|185/185|d.67.3.1|1/1|Ribosome recycling factor, RRF| OP:NHOMO 1038 OP:NHOMOORG 998 OP:PATTERN -------------------------------------------------------------------- 1111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111111111111111111111111111111111111111112111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-1111111-111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-1111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111111111111111111 ----111-----111---------------------------------1-----------------111-1-1-------------11-----11-111-111111-141211--111-1-11111-1-541-121-1111-111-1---1--1111-1---11-1-1-1---1121229222212222-214222111 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 186 STR:RPRED 99.5 SQ:SECSTR cccHcHHHHHHHHHHHHHHHHHHHHHHHcccccccGGGGTTcEEEETTEEEEGGGcEEEEEccTTEEEEEEccTTHHHHHHHHHHHcccccccEEccccEEEEcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHc# DISOP:02AL 1-1| PSIPRED cccHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHccEEEEEcccEEEEEEEEEEEcccccEEEEEEccHHHHHHHHHHHHHccccccccccccEEEEEcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc //