[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : ftsY
DDBJ      :ftsY         Cell division protein
Swiss-Prot:             

Homologs  Archaea  67/68 : Bacteria  898/915 : Eukaryota  192/199 : Viruses  0/175   --->[See Alignment]
a.24.13b.65.1c.37.1
:423 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   157->419 1zu5A PDBj 5e-61 45.2 %
:RPS:PDB   156->416 2cnwE PDBj 2e-40 42.3 %
:RPS:SCOP  157->252 1eg7A  c.37.1.10 * 8e-13 17.8 %
:RPS:SCOP  258->374 1f3uA  b.65.1.1 * 2e-26 16.5 %
:HMM:SCOP  110->191 1vmaA1 a.24.13.1 * 1.8e-20 44.4 %
:HMM:SCOP  207->418 1ls1A2 c.37.1.10 * 8.8e-55 39.3 %
:RPS:PFM   215->411 PF00448 * SRP54 3e-54 55.5 %
:HMM:PFM   215->415 PF00448 * SRP54 1.9e-82 59.0 195/196  
:HMM:PFM   118->193 PF02881 * SRP54_N 1.3e-18 34.7 72/75  
:BLT:SWISS 115->419 FTSY_BACSU 1e-86 58.9 %
:PROS 389->402|PS00300|SRP54
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABD99437.1 GT:GENE ftsY GT:PRODUCT Cell division protein GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION 673058..674329 GB:FROM 673058 GB:TO 674329 GB:DIRECTION + GB:GENE ftsY GB:PRODUCT Cell division protein GB:NOTE COG0541 [U] Signal recognition particle GTPase GB:PROTEIN_ID ABD99437.1 GB:DB_XREF GI:90820798 GB:GENE:GENE ftsY LENGTH 423 SQ:AASEQ MGLFDRIRKAFSSQDDEEKIKQETVDNDEESMKSKENSSDSDSDVVSEEKTSKDVDQSVDSQEKNSDESEEDNDEILDSNGDNSEFVEEENSNDSSEQNDNLKVEEKVSSDEEERYDKGLEKSRKGFGAMINSLLANFRHVDEDFFEELEETLIEADVGFETAMKISDELRQEVKLRNAKKKNEISDAIIEKLVEIYENEGKEEDNNLHFSSEGPTVFLFVGVNGVGKTTTIGKLAHRYKMEGKKVMLAAADTFRAGAIEQLAEWGRRVGVTVVKKVEKSDPAAVVFDAVKKAKEEDYDILLVDTAGRLQNKVNLMKELEKIARVITREIPDAPHEVLLALDATTGQNALTQAKQFKDVTNVTGIVLTKLDGTAKGGIVLAIRNELHLPVKLVGLGEKMDDLRDFSPEEYVVGLFKGLVTPSK GT:EXON 1|1-423:0| BL:SWS:NREP 1 BL:SWS:REP 115->419|FTSY_BACSU|1e-86|58.9|304/329| PROS 389->402|PS00300|SRP54|PDOC00272| SEG 27->49|ndeesmkskenssdsdsdvvsee| SEG 60->80|dsqeknsdeseedndeildsn| SEG 82->101|dnsefveeensndsseqndn| SEG 103->114|kveekvssdeee| SEG 142->155|dedffeeleetlie| SEG 266->277|grrvgvtvvkkv| SEG 283->294|aavvfdavkkak| BL:PDB:NREP 1 BL:PDB:REP 157->419|1zu5A|5e-61|45.2|261/309| RP:PDB:NREP 1 RP:PDB:REP 156->416|2cnwE|2e-40|42.3|260/279| RP:PFM:NREP 1 RP:PFM:REP 215->411|PF00448|3e-54|55.5|191/196|SRP54| HM:PFM:NREP 2 HM:PFM:REP 215->415|PF00448|1.9e-82|59.0|195/196|SRP54| HM:PFM:REP 118->193|PF02881|1.3e-18|34.7|72/75|SRP54_N| GO:PFM:NREP 2 GO:PFM GO:0005525|"GO:GTP binding"|PF00448|IPR000897| GO:PFM GO:0006614|"GO:SRP-dependent cotranslational protein targeting to membrane"|PF00448|IPR000897| RP:SCP:NREP 2 RP:SCP:REP 157->252|1eg7A|8e-13|17.8|90/549|c.37.1.10| RP:SCP:REP 258->374|1f3uA|2e-26|16.5|115/118|b.65.1.1| HM:SCP:REP 110->191|1vmaA1|1.8e-20|44.4|81/0|a.24.13.1|1/1|Domain of the SRP/SRP receptor G-proteins| HM:SCP:REP 207->418|1ls1A2|8.8e-55|39.3|206/0|c.37.1.10|1/1|P-loop containing nucleoside triphosphate hydrolases| OP:NHOMO 2476 OP:NHOMOORG 1157 OP:PATTERN 22222222111222222222222222222222222222222222222222222222222222222-22 2222222222222222222-22222222222222222222222222122222222222222222222222222222222222232332222222222--222222222222222222222222222222222222222222---2222222222222222222222222222222222222222222222-32232323233233333323222233322223222222223322222222222222122222221222222222222222222222122222222222222222222222222222222222222222222233223333333333232332222333223332333323333323323222222222222222222222222222222222222222-22222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222322223322222223222222222232222222222222222222222222222222222222222233222222222222222232322222222333323233333332333333332322222222222222233333332333333223222-2222222222222222222222222222-2222222222222222222222222222222222222222222222222122222222222222222222222222222222222222222222222222212222222222222222222222222222222222222223333333333222222222222222223------2333233322222222-22222222222222222223223332323222 2212221-622222211112222222222111122111111111112222222211222212211111211-2111121111111112-1111111111112111121351231112121112-33-3-2B2-2431121221221212221121122114411111112512214434s44444458B2664432224 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 305 STR:RPRED 72.1 SQ:SECSTR ##################################################################################################################HHHHHcHHHHHHHHHHHHTTTTcccHHHHHHHHHHHHHHHHTTccHHHHHHHHHHHccccccHHHHHHHHHHHHccccHHHHHHHHTcccccccccccccccEEEEEccTTccHHHHHHHHHHHHHTTTccEEEEccccccTTTTHHHHHHHHHHTccEEcccTTccHHHHHHHHHHHHHHHTccEEEEccccccTTcHHHHHHHHHHHHHHHHHcTTcccEEEEEEETTccTHHHHHHHHHHHHHcccEEEEEcTTcccccTTHHHHHHHHcccEEEEEccccTTcEEEccHHHHHHHHTcTcc#### DISOP:02AL 1-1,11-77,85-126,177-177,423-424| PSIPRED ccHHHHHHHHHccccHHHHHHHHHcccHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHcccccHHHccHHHHHcccccHHHHHHccccccccccccccHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHccccccHHHHccccccccEEEEEEccccccHHHHHHHHHHHHHHccccEEEEEcccccHHHHHHHHHHHHHHcEEEEEEcccccHHHHHHHHHHHHHHccccEEEEcccccccccHHHHHHHHHHHHHHHHcccccccEEEEEEEccccHHHHHHHHHHHHcccccEEEEEcccccccHHHHHHHHHHHcccEEEEEccccccccccccHHHHHHHHHHHHHHHcc //