[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : ftsZ
DDBJ      :ftsZ         Cell division protein
Swiss-Prot:             

Homologs  Archaea  42/68 : Bacteria  874/915 : Eukaryota  27/199 : Viruses  0/175   --->[See Alignment]
c.32.1d.79.2
:417 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   30->315 2vxyA PDBj 2e-99 67.5 %
:RPS:PDB   30->333 2btqB PDBj 3e-46 10.2 %
:RPS:SCOP  30->206 1fszA1  c.32.1.1 * 2e-50 40.9 %
:RPS:SCOP  208->329 1fszA2  d.79.2.1 * 8e-41 41.0 %
:HMM:SCOP  13->206 1w5fA1 c.32.1.1 * 5.2e-69 54.1 %
:HMM:SCOP  205->324 1w5fA2 d.79.2.1 * 1.8e-46 59.2 %
:RPS:PFM   223->318 PF12327 * FtsZ_C 5e-25 63.5 %
:HMM:PFM   14->185 PF00091 * Tubulin 1.2e-40 29.1 172/216  
:HMM:PFM   223->318 PF12327 * FtsZ_C 3.7e-36 51.0 96/97  
:HMM:PFM   341->400 PF12490 * BCAS3 0.00095 18.6 59/244  
:BLT:SWISS 1->416 FTSZ_ENTFA e-126 65.6 %
:PROS 45->79|PS01134|FTSZ_1
:PROS 98->119|PS01135|FTSZ_2
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABD99855.1 GT:GENE ftsZ GT:PRODUCT Cell division protein GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION complement(1070613..1071866) GB:FROM 1070613 GB:TO 1071866 GB:DIRECTION - GB:GENE ftsZ GB:PRODUCT Cell division protein GB:NOTE COG0206 [D] Cell division GTPase GB:PROTEIN_ID ABD99855.1 GB:DB_XREF GI:90821216 GB:GENE:GENE ftsZ LENGTH 417 SQ:AASEQ MEYSLDSSQNTGANIKVIGVGGAGGNAVNRMIADDVKGVEFIVANTDVQALQHSNAETKIQLGPKLTRGLGAGSNPEIGSKAAQESEEAIAEALSGADMIFVTAGMGGGTGTGAAPIIAKIAKEQGALTVGVVTRPFSFEGPKRARFAAEGVAQMKEHVDTLVIIANNRLLEIVDKKTPMLQAFQEADNVLRQGVQGISDLITSPGYVNLDFADVKTVMQNQGSALMGIGTANGENRTAEATKKAISSPLLEVSIDGAEQVLLNITGGPDLSLFEAQDASDIVAQAATSDINIIFGTSINEELEDSVIVTVIATGIDKKKKEAPKRTRMSNPLNNAGINHSTTGVNETTTRSQGDPLGDWDLSREMNNSRQATQNERGNDFQNVEKKDFDVFQADSDADDSNDDSLNTPPFLRRRRR GT:EXON 1|1-417:0| BL:SWS:NREP 1 BL:SWS:REP 1->416|FTSZ_ENTFA|e-126|65.6|410/410| PROS 45->79|PS01134|FTSZ_1|PDOC00873| PROS 98->119|PS01135|FTSZ_2|PDOC00873| SEG 12->29|ganikvigvggaggnavn| SEG 80->97|skaaqeseeaiaealsga| SEG 103->115|tagmgggtgtgaa| SEG 394->405|adsdaddsndds| BL:PDB:NREP 1 BL:PDB:REP 30->315|2vxyA|2e-99|67.5|286/306| RP:PDB:NREP 1 RP:PDB:REP 30->333|2btqB|3e-46|10.2|304/391| RP:PFM:NREP 1 RP:PFM:REP 223->318|PF12327|5e-25|63.5|96/98|FtsZ_C| HM:PFM:NREP 3 HM:PFM:REP 14->185|PF00091|1.2e-40|29.1|172/216|Tubulin| HM:PFM:REP 223->318|PF12327|3.7e-36|51.0|96/97|FtsZ_C| HM:PFM:REP 341->400|PF12490|0.00095|18.6|59/244|BCAS3| RP:SCP:NREP 2 RP:SCP:REP 30->206|1fszA1|2e-50|40.9|176/209|c.32.1.1| RP:SCP:REP 208->329|1fszA2|8e-41|41.0|122/125|d.79.2.1| HM:SCP:REP 13->206|1w5fA1|5.2e-69|54.1|194/0|c.32.1.1|1/1|Tubulin nucleotide-binding domain-like| HM:SCP:REP 205->324|1w5fA2|1.8e-46|59.2|120/0|d.79.2.1|1/1|Tubulin C-terminal domain-like| OP:NHOMO 1091 OP:NHOMOORG 943 OP:PATTERN -----------------------22222222311122222222221221222212222222-2242-- 1111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111--11111111111---------------11111112111222112221111111111111111111111111111111111111111111111111111111111111111111111111111121111111111111111111111111-11111111111111111111111111111111111-1111111111111111111111111111111111111111111111111111111111111111111121111111111111111111411-111111111112111111112111111111111-11111111121132222222222211111111111111111111111111112-11121111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111211111111111111211112111111111111111111111111111111112111112112111111111211222111111111-1111111111111111111111111111-11111111111111111111111111111111111111111111-111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111--1111111111111111111----1-111-1--111-11111---1111111111-11 ----22-1----------------------------------------------------------------------------------------------------2------------------------------------------------------------------4222O222115354-433442222 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 304 STR:RPRED 72.9 SQ:SECSTR #############################TTTEEEEETTEEEEcEEEEEEccccccTTcEEEcccccTTcHHHHHTHHHHHHHHHHHHHHHHHHTTcccEEccccTTTHHHHHHHHHHHTTcTTcEEEEEEEEccGGGcccTTHHHHHHHHHHHHHHHccEEEEEEHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHcccTTccEEEEEccccccHHHHHHHTcGGGcccccTTTccEEEEEEEEEcccTTTTHHHHHTTccccTTccccccEEEEEEccccTTccccccEEEEEGGGHHHHHHHHHHHHH#################################################################################### DISOP:02AL 317-399,416-418| PSIPRED ccccccccHHcccEEEEEEEcccccHHHHHHHHccccccEEEEEccHHHHHHccccccEEEEccccccccccccccHHccHHHHHHHHHHHHHcccccEEEEEcccccccccccHHHHHHHHHHccccEEEEEEcccccHHHHHHHHHHHHHHHHHHHccEEEEEEHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHccccEEccHHHHHHHHHHccEEEEEEEEEccccHHHHHHHHHHcccccccccccccEEEEEEEccccccHHHHHHHHHHHHHHHccccEEEEEEEEccccccEEEEEEEEEccccccccccHHHHHHccccccccccccccccccccccccccHHHccccccccccccccccccccccccccccccccccccccccccccccccccHHHHcccc //