[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : fur.1
DDBJ      :fur          Ferric uptake regulation protein
Swiss-Prot:             

Homologs  Archaea  15/68 : Bacteria  599/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.4.5
:147 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   19->144 2fe3B PDBj 4e-25 40.8 %
:RPS:PDB   24->140 1b4aA PDBj 3e-06 16.5 %
:RPS:SCOP  8->140 1mzbA  a.4.5.42 * 2e-26 27.8 %
:HMM:SCOP  8->140 1mzbA_ a.4.5.42 * 1.3e-35 38.6 %
:RPS:PFM   22->134 PF01475 * FUR 4e-20 42.9 %
:HMM:PFM   17->135 PF01475 * FUR 5.2e-34 40.7 118/120  
:BLT:SWISS 14->144 PERR_STAAN 4e-25 39.2 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE00172.1 GT:GENE fur.1 GT:PRODUCT Ferric uptake regulation protein GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION complement(1434677..1435120) GB:FROM 1434677 GB:TO 1435120 GB:DIRECTION - GB:GENE fur GB:PRODUCT Ferric uptake regulation protein GB:NOTE COG0735 [P] Fe2+/Zn2+ uptake regulation proteins GB:PROTEIN_ID ABE00172.1 GB:DB_XREF GI:90821533 GB:GENE:GENE fur LENGTH 147 SQ:AASEQ MNNQEQLMMAAEKLKKRHIKNTPQRQVILAYLMSSKEHPSIEMIYSYVKENGFSVSLATVYNTLELFMDRKLIIEVTPDNEGHMRYDYFAEPHYHVICVNCNKIIDVPNDEYVKLEKDAAEKTGFKVFNSQYEVYGLCPECQAKIAD GT:EXON 1|1-147:0| BL:SWS:NREP 1 BL:SWS:REP 14->144|PERR_STAAN|4e-25|39.2|130/148| BL:PDB:NREP 1 BL:PDB:REP 19->144|2fe3B|4e-25|40.8|125/143| RP:PDB:NREP 1 RP:PDB:REP 24->140|1b4aA|3e-06|16.5|115/146| RP:PFM:NREP 1 RP:PFM:REP 22->134|PF01475|4e-20|42.9|112/120|FUR| HM:PFM:NREP 1 HM:PFM:REP 17->135|PF01475|5.2e-34|40.7|118/120|FUR| GO:PFM:NREP 2 GO:PFM GO:0003700|"GO:transcription factor activity"|PF01475|IPR002481| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF01475|IPR002481| RP:SCP:NREP 1 RP:SCP:REP 8->140|1mzbA|2e-26|27.8|133/133|a.4.5.42| HM:SCP:REP 8->140|1mzbA_|1.3e-35|38.6|132/134|a.4.5.42|1/1|"Winged helix" DNA-binding domain| OP:NHOMO 947 OP:NHOMOORG 614 OP:PATTERN --------1111111--11-111---------------------------21----------1----- 122---1111111111111-1---1-11111--11111111112--1-1---1111-1---11-1-1131-1---111-1112224332222-1------111-1-2111---------------1-133222233-----44411C2-1111223311-11-32131112111-11111-1-22-22211123333333333333333225523333333223322222234233333333333333233322-2-22-1---22112231111-1111111111111-----------1111111111111111111111122232232232233322773222231233213-22522-23245453-1-12111111-11---111111111111111111-111---------1-1-211111-111--1111111-111111111111111-1111212-----------------------------1111111----------1-----------------1--1--111-----1--------1-111-1111111------131-11132342231313223121222212142222222222212111111112122--113------111-11---1------1-------1-12------1111-111111111111-1111111111111111111111111111111111111111111111111111-111111111111----1111-11-1---1-11111-11111-111111111111---11-1----1----1---111111111-111------111-1--------------11-111-1--------------------------------------2211222222--- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 137 STR:RPRED 93.2 SQ:SECSTR #######cHHHHHHHHTTccccHHHHHHHHHHHHHcccccHHHHHHHHHHTTccccHHHHHHHHHHTTcEEEEccccccEEEEcTTcccccHHHHHHHHHHHHEEEEETEEEEEEcTTcHHHHHHcHHHHHTTEEEEEEcHHHH### DISOP:02AL 1-5,143-148| PSIPRED cccHHHHHHHHHHHHHccccccHHHHHHHHHHHHccccccHHHHHHHHHHHcccccHHHHHHHHHHHHHcccEEEEEEccccEEEEEcccccccEEEEcccccEEEEcccHHHHHHHHHHHHHccEEEEEEEEEEEEcHHHHHHHcc //