[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : fur.2
DDBJ      :fur          Ferric uptake regulation protein
Swiss-Prot:             

Homologs  Archaea  1/68 : Bacteria  258/915 : Eukaryota  2/199 : Viruses  0/175   --->[See Alignment]
a.4.5
:143 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   16->141 2fe3B PDBj 8e-18 36.4 %
:RPS:PDB   17->101 1bibA PDBj 2e-04 14.3 %
:RPS:SCOP  6->138 1mzbA  a.4.5.42 * 1e-19 23.8 %
:HMM:SCOP  5->138 1mzbA_ a.4.5.42 * 4.6e-31 33.3 %
:RPS:PFM   16->132 PF01475 * FUR 3e-11 31.6 %
:HMM:PFM   14->133 PF01475 * FUR 6.1e-26 31.6 117/120  
:BLT:SWISS 4->139 ZUR_BACSU 1e-29 42.9 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE00254.1 GT:GENE fur.2 GT:PRODUCT Ferric uptake regulation protein GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION complement(1508093..1508524) GB:FROM 1508093 GB:TO 1508524 GB:DIRECTION - GB:GENE fur GB:PRODUCT Ferric uptake regulation protein GB:NOTE COG0735 [P] Fe2+/Zn2+ uptake regulation proteins GB:PROTEIN_ID ABE00254.1 GB:DB_XREF GI:90821615 GB:GENE:GENE fur LENGTH 143 SQ:AASEQ MTLVKEAISILKEHNLKITKQRQALLEYLSNYQHRYVDITQVDKYMHTLFPGMSHNTIYRNIKDFDNLGIIETQEKPSGACVKYQCDFGNLHHHHFICEKCGKVEEINLCPLNDLLQTQLPGYQIDGHRFEVYGVCDKCRKNS GT:EXON 1|1-143:0| BL:SWS:NREP 1 BL:SWS:REP 4->139|ZUR_BACSU|1e-29|42.9|133/145| BL:PDB:NREP 1 BL:PDB:REP 16->141|2fe3B|8e-18|36.4|121/143| RP:PDB:NREP 1 RP:PDB:REP 17->101|1bibA|2e-04|14.3|77/294| RP:PFM:NREP 1 RP:PFM:REP 16->132|PF01475|3e-11|31.6|114/120|FUR| HM:PFM:NREP 1 HM:PFM:REP 14->133|PF01475|6.1e-26|31.6|117/120|FUR| GO:PFM:NREP 2 GO:PFM GO:0003700|"GO:transcription factor activity"|PF01475|IPR002481| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF01475|IPR002481| RP:SCP:NREP 1 RP:SCP:REP 6->138|1mzbA|1e-19|23.8|130/133|a.4.5.42| HM:SCP:REP 5->138|1mzbA_|4.6e-31|33.3|132/134|a.4.5.42|1/1|"Winged helix" DNA-binding domain| OP:NHOMO 385 OP:NHOMOORG 261 OP:PATTERN --------------------------------------------------1----------------- -1-1-111111111-------1--12-----11-------1--------------111--11---12----1----------1112--11------------------------------------------1-11-11--113--1-----------------1---------------------111--222222222222222222224422222222232222222234222222222222222222222-2-11-1---222222212-11------1---111------------------------1-1111111-13221-------11111231---121222--2-22411111214321------1--1-----------------------------------------------------------------------------------------------------------------------------------------------------------11--11113---1211---11--1111111------22---1-2111111-2221122-1-----12-1111211111-----------1111----1--1---1-11221---1------1-11---1111---------------------------------------------------------------------------------------------1111111-1----------------------------1----------------------------------------------------------1----------------------------------------------11-11-1111-- -------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------1---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 133 STR:RPRED 93.0 SQ:SECSTR ########HHHHHTTccccHHHHHHHHHHTHcTcccccHHHHHHHHTTTcTTccHHHHHHHHHHHHHTTcccEEEETTTEEEcccccccccHHHHHHTcccccEEEccccccHHHHHHHHHcccccccEEEEEEccHHHHH## DISOP:02AL 1-3,141-144| PSIPRED ccHHHHHHHHHHHccccccHHHHHHHHHHHHcccccccHHHHHHHHHHHcccccHHHHHHHHHHHHHcccEEEEEEcccEEEEEEcccccccccEEEEcccccEEEcccccHHHHHHHHHcccEEEEEEEEEEEEcHHHHHcc //