[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : gAlE
DDBJ      :gAlE         UDP-glucose 4-epimerase
Swiss-Prot:             

Homologs  Archaea  66/68 : Bacteria  821/915 : Eukaryota  163/199 : Viruses  3/175   --->[See Alignment]
c.2.1
:319 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   3->305 1sb9A PDBj 1e-33 30.1 %
:RPS:PDB   2->315 1e7rA PDBj 5e-40 19.7 %
:RPS:SCOP  3->310 1sb8A  c.2.1.2 * 1e-59 29.9 %
:HMM:SCOP  4->313 1eq2A_ c.2.1.2 * 2.1e-77 35.7 %
:RPS:PFM   6->243 PF01370 * Epimerase 1e-35 37.3 %
:HMM:PFM   6->246 PF01370 * Epimerase 1.2e-56 34.9 235/238  
:BLT:SWISS 6->309 GALE_METJA 1e-39 32.8 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABD99775.1 GT:GENE gAlE GT:PRODUCT UDP-glucose 4-epimerase GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION complement(985055..986014) GB:FROM 985055 GB:TO 986014 GB:DIRECTION - GB:GENE gAlE GB:PRODUCT UDP-glucose 4-epimerase GB:NOTE COG0451 [MG] Nucleoside-diphosphate-sugar epimerases GB:PROTEIN_ID ABD99775.1 GB:DB_XREF GI:90821136 GB:GENE:GENE gAlE LENGTH 319 SQ:AASEQ MRKKYLVTGGAGFIGSNLIEKIISQGDEVVVVGRHLPAECKEDDNNLKDNITFYQADVTYYEFMEQLLIKEKFDYIVLLAAVISISGTIAEPLSTHFINQEAILYIYEIIRKNKLKVKKVLFTSSSAVYGNIADTPRREDMPVSLENPYAIDKFASERYAMFYEKVYGIPTVAVRFFNVYGPRQKAQGKSAGVCAIILDCLLNDKEFRLNGDGKQTRDYMYVTDAVDATLMLLKDPQISGKIFNVASGKSVSLIDLIVAFEEITGKKLKIIHNKGLKFDTKNSLADITKLEKTGFLPKYTFESGLRQYVKEEKRRLGYS GT:EXON 1|1-319:0| BL:SWS:NREP 1 BL:SWS:REP 6->309|GALE_METJA|1e-39|32.8|293/305| BL:PDB:NREP 1 BL:PDB:REP 3->305|1sb9A|1e-33|30.1|299/340| RP:PDB:NREP 1 RP:PDB:REP 2->315|1e7rA|5e-40|19.7|295/314| RP:PFM:NREP 1 RP:PFM:REP 6->243|PF01370|1e-35|37.3|228/232|Epimerase| HM:PFM:NREP 1 HM:PFM:REP 6->246|PF01370|1.2e-56|34.9|235/238|Epimerase| GO:PFM:NREP 3 GO:PFM GO:0003824|"GO:catalytic activity"|PF01370|IPR001509| GO:PFM GO:0044237|"GO:cellular metabolic process"|PF01370|IPR001509| GO:PFM GO:0050662|"GO:coenzyme binding"|PF01370|IPR001509| RP:SCP:NREP 1 RP:SCP:REP 3->310|1sb8A|1e-59|29.9|304/341|c.2.1.2| HM:SCP:REP 4->313|1eq2A_|2.1e-77|35.7|297/307|c.2.1.2|1/1|NAD(P)-binding Rossmann-fold domains| OP:NHOMO 4771 OP:NHOMOORG 1053 OP:PATTERN 11311-32444335422512134393336543375325132225736866665133322333344-15 79E4622433511125344-42225344444434442325398713-1-443544213115321656648323332222122746755898626221--64657788A87--------------444645776765CCC8C-11A597879982244544234253876967336556576373331122413555546985567689737665466A45223431112118A2111111111111114---26111322231344114324222221123223334333442422432411111111111114223332222331945555666455814433425261-5214244A767233212122414A86568-----55DC7554776AB33423244425-BBAGBGAA48326663EG7CJDAA74532243968945-5555555523535C97-----------------------------2344214773496666976666779C566655679655435664B22332355323358442442233332344695365994C98A7BA98AA8975D6876777D68444314555532432222324243265748444442172245424233334434234--16534------56655767886767685-8878696776866567768645335568477888688798975677377773-734454444545-14-5555511116354333233333333333231111133335243543453245342355333322333442342222225136353444422244342-B855AAAA111111113-1----------1-1---23-1-----1133522221785 -122214-1-11466211---1-2122------111----------1211232211112111222-11-2-12-211-1112222322-11211112121--1355-6D3634334222-213353242AB4-343132-3-3321242132131323446547231244U45749567*CA955UNVX1YJ78A7877 -----------------------3--------------------------------------------------------------------------------------------------------------------------------------------------12--- STR:NPRED 319 STR:RPRED 100.0 SQ:SECSTR HcEEEEEETTTcHHHHHHHHHHTTcTTEEEEcccTccGGGTGGGTTcTTEEETTccTTcHHHHHHHHHHHcccEEEEcccccccHHHHHHcHHHHHHHHHHHHHHHHHHHHHTTcTccEEEEEccGGGccTTcccccTcccccGGGHHHHHHHHHHHHHHHHHHHHHccEEEEEEEcEEEcTTccccTTcccHHHHHHHHHHTccEEEEEcccccEEcEEEHHHHHHHHHHHHHccHHHHccEEEcccccEEHHHHHHHHHHHHTcccEEEEETTccccccccccccHHHHHTTccccccHHHHHHHHHHHHHHTHTcc DISOP:02AL 1-1,318-320| PSIPRED cccEEEEEccccHHHHHHHHHHHHcccEEEEEEcccccHHHHHHHHHccccEEEEcccccHHHHHHHHHHccccEEEEccccccHHHHHHcHHHHHHHHHHHHHHHHHHHHHHcccccEEEEEEEccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHccccEEEEEEccccccccccccccccHHHHHHHHHHccccEEEEEccccEEEEEEHHHHHHHHHHHHHcccccccEEEEcccccEEHHHHHHHHHHHHcccccEEEcccccccccEEcccHHHHHHccccccccHHHHHHHHHHHHHHHcccc //