[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : glgC.2
DDBJ      :glgC         Glucose-1-phosphate adenylyltransferase catalytic subunit
Swiss-Prot:GLGC_LACS1   RecName: Full=Glucose-1-phosphate adenylyltransferase;         EC=2.7.7.27;AltName: Full=ADP-glucose synthase;AltName: Full=ADP-glucose pyrophosphorylase;         Short=ADPGlc PPase;

Homologs  Archaea  60/68 : Bacteria  651/915 : Eukaryota  88/199 : Viruses  0/175   --->[See Alignment]
b.81.1c.68.1
:380 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   9->341 3brkX PDBj 6e-57 42.9 %
:RPS:PDB   16->275 3bmaA PDBj 5e-51 10.4 %
:RPS:SCOP  8->277 1yp2A2  c.68.1.6 * 2e-83 38.3 %
:RPS:SCOP  294->342 2f9cA1  b.81.1.7 * 4e-06 36.7 %
:HMM:SCOP  1->340 1yp2A2 c.68.1.6 * 4.3e-88 39.0 %
:RPS:PFM   6->252 PF00483 * NTP_transferase 2e-34 40.5 %
:HMM:PFM   7->259 PF00483 * NTP_transferase 1.1e-73 38.4 237/248  
:HMM:PFM   344->359 PF00132 * Hexapep 7.1e-05 56.2 16/18  
:HMM:PFM   309->341 PF07959 * Fucokinase 0.00085 27.3 33/413  
:BLT:SWISS 1->380 GLGC_LACS1 0.0 100.0 %
:PROS 11->30|PS00808|ADP_GLC_PYROPHOSPH_1
:PROS 98->106|PS00809|ADP_GLC_PYROPHOSPH_2
:PROS 189->199|PS00810|ADP_GLC_PYROPHOSPH_3
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE00100.1 GT:GENE glgC.2 GT:PRODUCT Glucose-1-phosphate adenylyltransferase catalytic subunit GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION complement(1336603..1337745) GB:FROM 1336603 GB:TO 1337745 GB:DIRECTION - GB:GENE glgC GB:PRODUCT Glucose-1-phosphate adenylyltransferase catalytic subunit GB:NOTE COG0448 [G] ADP-glucose pyrophosphorylase GB:PROTEIN_ID ABE00100.1 GB:DB_XREF GI:90821461 GB:GENE:GENE glgC LENGTH 380 SQ:AASEQ MKNEMLGVILAGGKGTRLGKLTHNQAKPAVPFGGRYRIIDFTLSNCVNSGVKNIGVITQYQPLNLNAHIGNGASWGLDDLNAGVTILQPYSNNEGSKWFEGTAHAIYQNIGYIDQMDPEYILILSGDHIYKMDYEAMLDQHKETGASLTVAVIDVPWDEASRFGIMNTDDNNRIIDFEEKPAEPKSNHASMGIYIFNWKRLREVLVNSFTRNQDMVDFGKNVIPYYLKSGESVFAYNFKGYWKDVGTIDSLWHANMEFLDENNELNLQDRTWRIYSRNPIAPPQIIAETAEIKDAMIVDGSYIAGKVDHSILSANVRIQTGSVVTDSVIMPGAKIGKNVTIHRAIIGEGAVIGDDVVIDGTDEIAVIGNKEVVGVTSHEE GT:EXON 1|1-380:0| SW:ID GLGC_LACS1 SW:DE RecName: Full=Glucose-1-phosphate adenylyltransferase; EC=2.7.7.27;AltName: Full=ADP-glucose synthase;AltName: Full=ADP-glucose pyrophosphorylase; Short=ADPGlc PPase; SW:GN Name=glgC; OrderedLocusNames=LSL_1293; SW:KW ATP-binding; Complete proteome; Glycogen biosynthesis;Nucleotide-binding; Nucleotidyltransferase; Transferase. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->380|GLGC_LACS1|0.0|100.0|380/380| GO:SWS:NREP 5 GO:SWS GO:0005524|"GO:ATP binding"|ATP-binding| GO:SWS GO:0005978|"GO:glycogen biosynthetic process"|Glycogen biosynthesis| GO:SWS GO:0000166|"GO:nucleotide binding"|Nucleotide-binding| GO:SWS GO:0016779|"GO:nucleotidyltransferase activity"|Nucleotidyltransferase| GO:SWS GO:0016740|"GO:transferase activity"|Transferase| PROS 11->30|PS00808|ADP_GLC_PYROPHOSPH_1|PDOC00638| PROS 98->106|PS00809|ADP_GLC_PYROPHOSPH_2|PDOC00638| PROS 189->199|PS00810|ADP_GLC_PYROPHOSPH_3|PDOC00638| SEG 344->364|aiigegavigddvvidgtdei| BL:PDB:NREP 1 BL:PDB:REP 9->341|3brkX|6e-57|42.9|310/386| RP:PDB:NREP 1 RP:PDB:REP 16->275|3bmaA|5e-51|10.4|249/392| RP:PFM:NREP 1 RP:PFM:REP 6->252|PF00483|2e-34|40.5|227/238|NTP_transferase| HM:PFM:NREP 3 HM:PFM:REP 7->259|PF00483|1.1e-73|38.4|237/248|NTP_transferase| HM:PFM:REP 344->359|PF00132|7.1e-05|56.2|16/18|Hexapep| HM:PFM:REP 309->341|PF07959|0.00085|27.3|33/413|Fucokinase| GO:PFM:NREP 2 GO:PFM GO:0009058|"GO:biosynthetic process"|PF00483|IPR005835| GO:PFM GO:0016779|"GO:nucleotidyltransferase activity"|PF00483|IPR005835| RP:SCP:NREP 2 RP:SCP:REP 8->277|1yp2A2|2e-83|38.3|261/293|c.68.1.6| RP:SCP:REP 294->342|2f9cA1|4e-06|36.7|49/320|b.81.1.7| HM:SCP:REP 1->340|1yp2A2|4.3e-88|39.0|277/0|c.68.1.6|1/2|Nucleotide-diphospho-sugar transferases| OP:NHOMO 1699 OP:NHOMOORG 799 OP:PATTERN 221-2-33344343531122222144444324122111-1---221322554324343335212-1-1 2133133233222122222-22222122222222222232444411111111222221--1111421533121111112-13412-22-311-1-----1121-132121111111111111111111-14---22555661225366543453344333233344A444423222322223342311212-31444443433454334132213334223-423------252-------------------12--23-111123--22-3-21-323233322232222222223222-------------322111112343-531111212314424433221-5221342144653132112313322212-111------222211121221-----------------1-1-2-112211222121111--1-2132331----------1---1121-------------------------------11--1----11212211111--331111111141121---11212--11-31122231121---22221121132--412-21-1-21-2413323211121123111-1-----1---1-------1---211342222-13-53222211222122122212---2322------12223232111221221-12211111211212222212221121122-313121123133212222221--322222212222-------------211-2211211-11111111-----1111-1311111--1-1111-1213-111111-151212222243322--11-111111111--33222211--------1-1----------------2--------334454334311- 11--1-1-31---12------------------111------------1-------------11--11-112-2--------111-11--------1-1-23-1-211-23111---11-----2112-342-11--1--111-1-1------------1121221-2124212--463i33344E79C-A5--1111- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 343 STR:RPRED 90.3 SQ:SECSTR cccccEEEEEcccccccHHHHHcHHHHHHHHTcccccEEEEEccHHTTcccEEEEEEccTTccHHHHHHHHTTcHHHHTTcEEEEEccGGGccccccHHHHTTTccHHHHHHHHHccccHHHHHHHHHHHHHTTHHHHHHHHTcHHHHHHHHHHHHHHHHTTcccTTTTHHHHHTcTTTTTTcccccEEEEEEEEccHHHHHHHHHHHHHHTTccccccccHHHHHHHHTTcEEEccccHHHHHTTccHHHHHHHHHHHHHHHHTTTcccEEEcTcccEEEEcccEEEEEccccEEEEEEEETTcETTEEEEEEGGGGGGGHHHHHHcEEccEEEcTTEEEcT##################################### DISOP:02AL 1-2,373-373,375-381| PSIPRED ccccEEEEEEcccccccccHHHcccccHHEEEcccccHHHHHHHHHHHccccEEEEEEcccHHHHHHHHHHHHHcccHHccccEEEEccccccccccccccHHHHHHHHHHHHccccccEEEEEEccEEEcccHHHHHHHHHHccccEEEEEEEccHHHccccEEEEEcccccEEEEEEccccccccEEEEEEEEccHHHHHHHHHHccccccccEEcHHHHHHHHHHccccEEEEEEccEEEEcccHHHHHHHHHHHHHccccccccccccccccccEEcccEEEccccEEcccEEEcccEEEEEEEEEEEccccEEccccEEEEEEEccccEEccccEEEEEEEEcccEEcccEEEccccEEEEEccccEEccccccc //