[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : glmM.2
DDBJ      :glmM         Phosphoglucomutase
Swiss-Prot:             

Homologs  Archaea  35/68 : Bacteria  471/915 : Eukaryota  156/199 : Viruses  0/175   --->[See Alignment]
c.84.1d.129.2
:575 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   44->547 1wqaA PDBj 2e-14 27.1 %
:RPS:PDB   30->561 1c47A PDBj 6e-82 18.6 %
:RPS:SCOP  30->218 1c47A1  c.84.1.1 * 1e-31 18.8 %
:RPS:SCOP  207->322 1k2yX2  c.84.1.1 * 2e-15 16.5 %
:RPS:SCOP  327->454 1c47A3  c.84.1.1 * 4e-21 18.1 %
:RPS:SCOP  493->548 1k2yX4  d.129.2.1 * 2e-07 18.2 %
:HMM:SCOP  26->238 1kfiA1 c.84.1.1 * 2.1e-49 30.2 %
:HMM:SCOP  207->323 1k2yX2 c.84.1.1 * 7.7e-21 35.6 %
:HMM:SCOP  306->456 1kfiA3 c.84.1.1 * 6.1e-35 41.2 %
:HMM:SCOP  444->574 1wjwA_ d.129.2.1 * 5.1e-16 31.6 %
:RPS:PFM   42->172 PF02878 * PGM_PMM_I 3e-20 43.2 %
:RPS:PFM   209->312 PF02879 * PGM_PMM_II 4e-10 37.1 %
:RPS:PFM   327->450 PF02880 * PGM_PMM_III 4e-16 40.5 %
:RPS:PFM   493->547 PF00408 * PGM_PMM_IV 2e-07 44.4 %
:HMM:PFM   42->181 PF02878 * PGM_PMM_I 6.9e-40 38.1 134/138  
:HMM:PFM   210->314 PF02879 * PGM_PMM_II 1.3e-26 43.4 99/105  
:HMM:PFM   326->452 PF02880 * PGM_PMM_III 1.1e-21 27.3 110/111  
:HMM:PFM   480->566 PF00408 * PGM_PMM_IV 2.1e-16 37.7 53/73  
:BLT:SWISS 1->561 PGCA_BACSU e-156 46.7 %
:PROS 140->149|PS00710|PGM_PMM
:COIL
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABD99984.1 GT:GENE glmM.2 GT:PRODUCT Phosphoglucomutase GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION complement(1213148..1214875) GB:FROM 1213148 GB:TO 1214875 GB:DIRECTION - GB:GENE glmM GB:PRODUCT Phosphoglucomutase GB:NOTE COG1109 [G] Phosphomannomutase GB:PROTEIN_ID ABD99984.1 GB:DB_XREF GI:90821345 GB:GENE:GENE glmM LENGTH 575 SQ:AASEQ MSWQDTYQDWKENKELVEDLRADLVRMEGNQDELEDAFYAPLEFGTAGMRGVLGAGINRMNIYTVRQATEGLALFMETLDEETRKRGVAISYDSRHHSQDFAFESARVLGQHGIPTFVFESLRPTPELSFTVRHLHTYAGIMITASHNPKQYNGYKIYGEDGAQMPPKESDLITKYIRKVDDLFAIKVADQEELIEDGVLKVIGDEVDKAYLDEVKQVTINQELVAEEGKTMKLIFTPLHGTGAMLGEKALRQAGFENFTMVPEQAKPDPDFSTVKKPNPEDTAAFDLAIKLGKEEGADLLVAVDPDADRLGAAVRQPDGEYQLLTGNQIAAIMLNYILTARKNAGTLPANAAAVKSIVSSEFATKIAESFNVDMINVLTGFKFIAEQIKHFEDTNEHTFMFGFEESYGYLVRPFVRDKDAVQSLVMLAEVAAFYKKQGKNLYDGLQELFEKHGYFVEKTTSLTFDGVEGANKIKDLMAKFRAEAPKQFGDYKVVAMEDFDKSEKSYADGKVEAMTLPKSNVLKFLLEDGTWIAIRPSGTEPKIKFYIGTLGDTLEAATKKRSVFEEEINNFVNE GT:EXON 1|1-575:0| BL:SWS:NREP 1 BL:SWS:REP 1->561|PGCA_BACSU|e-156|46.7|559/581| PROS 140->149|PS00710|PGM_PMM|PDOC00589| COIL:NAA 28 COIL:NSEG 1 COIL:REGION 11->38| SEG 298->309|adllvavdpdad| SEG 564->574|vfeeeinnfvn| BL:PDB:NREP 1 BL:PDB:REP 44->547|1wqaA|2e-14|27.1|420/455| RP:PDB:NREP 1 RP:PDB:REP 30->561|1c47A|6e-82|18.6|505/561| RP:PFM:NREP 4 RP:PFM:REP 42->172|PF02878|3e-20|43.2|125/137|PGM_PMM_I| RP:PFM:REP 209->312|PF02879|4e-10|37.1|97/103|PGM_PMM_II| RP:PFM:REP 327->450|PF02880|4e-16|40.5|111/114|PGM_PMM_III| RP:PFM:REP 493->547|PF00408|2e-07|44.4|54/76|PGM_PMM_IV| HM:PFM:NREP 4 HM:PFM:REP 42->181|PF02878|6.9e-40|38.1|134/138|PGM_PMM_I| HM:PFM:REP 210->314|PF02879|1.3e-26|43.4|99/105|PGM_PMM_II| HM:PFM:REP 326->452|PF02880|1.1e-21|27.3|110/111|PGM_PMM_III| HM:PFM:REP 480->566|PF00408|2.1e-16|37.7|53/73|PGM_PMM_IV| GO:PFM:NREP 8 GO:PFM GO:0005975|"GO:carbohydrate metabolic process"|PF02878|IPR005844| GO:PFM GO:0016868|"GO:intramolecular transferase activity, phosphotransferases"|PF02878|IPR005844| GO:PFM GO:0005975|"GO:carbohydrate metabolic process"|PF02879|IPR005845| GO:PFM GO:0016868|"GO:intramolecular transferase activity, phosphotransferases"|PF02879|IPR005845| GO:PFM GO:0005975|"GO:carbohydrate metabolic process"|PF02880|IPR005846| GO:PFM GO:0016868|"GO:intramolecular transferase activity, phosphotransferases"|PF02880|IPR005846| GO:PFM GO:0005975|"GO:carbohydrate metabolic process"|PF00408|IPR005843| GO:PFM GO:0016868|"GO:intramolecular transferase activity, phosphotransferases"|PF00408|IPR005843| RP:SCP:NREP 4 RP:SCP:REP 30->218|1c47A1|1e-31|18.8|181/190|c.84.1.1| RP:SCP:REP 207->322|1k2yX2|2e-15|16.5|103/104|c.84.1.1| RP:SCP:REP 327->454|1c47A3|4e-21|18.1|116/117|c.84.1.1| RP:SCP:REP 493->548|1k2yX4|2e-07|18.2|55/96|d.129.2.1| HM:SCP:REP 26->238|1kfiA1|2.1e-49|30.2|192/203|c.84.1.1|1/1|Phosphoglucomutase, first 3 domains| HM:SCP:REP 207->323|1k2yX2|7.7e-21|35.6|104/104|c.84.1.1|1/1|Phosphoglucomutase, first 3 domains| HM:SCP:REP 306->456|1kfiA3|6.1e-35|41.2|119/120|c.84.1.1|1/1|Phosphoglucomutase, first 3 domains| HM:SCP:REP 444->574|1wjwA_|5.1e-16|31.6|95/0|d.129.2.1|1/1|Phosphoglucomutase, C-terminal domain| OP:NHOMO 887 OP:NHOMOORG 662 OP:PATTERN 11--2---1111111--1------11121111-21---------1--1--111-1111121-----11 22--111111111111111-31111111111111111111-11111211111111111111112111111--111---1212-2111111111111---1111111111112112121111111111111111121-----1112-11111111111------111122211-11111-11-2-11111-1121222222222222223111111222232-112222222212111111111111111111111111112212111111111111---2222222111111111111112222222222222111111111121121333332323212113111211111111122121-11111122-11-11-------------------------------------------------------------------------11111111------------------------------------------------------------------------------------------------1-1----------------1--1--1--1--1-222222222----11--------------------------1-----11------1111111111111111111--1---1-----------------------------------------------------------------------------------------------------------111-11111111111-----------------------------111111111-12222222222222-----------------111111111111111112----1-1-11111---2111--1112222212111111 11--1-1-31-111-1111111111111111111111111111111----------------11111111111112111111111111-1211111----12111111-122142332122221322222E2-222222222222221222225262221331111-31161221111-----1-----1--113111- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 532 STR:RPRED 92.5 SQ:SECSTR #############################ccEEEEccccTTccccTTcEEEEHHHHHHcTTHHHHHHHHHHHHTcHTTcHHHHTTcEEEEEEcccTTHHHHHHHHHHHHHHHTccEEEEEEEccHHHHHHHHHHHTccEEEEEccTTccccTTEEEEEETTcccccHHHHHHHHHHHHHccEEEEcTTccccTTccEccEEEEEEcccHHHHHHHHHHHccHHHHHHHcccccEEEEcTTcTHHHHHHHHTTTTcccGGGEEEETccccTTTTTcccccccTTTTHHHHHHHcHTccccEEEEEccccccEEEEEEcTEGGGccccHHHHHHHHHHcGGGcHHHHHccHccccEEEETTccTHHHHHHHTTTccEEEEcccTHHHHHHHHTccEETTTcccEEEETTTEEEHETTcccccHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHccEEEEEEEEEEEEcHHHHHHHHHHHHHHHTcTTccTTTcEEEETTEEEEEEEEccEEcTTTccEEccccEEEEETTccEEEEEEEEccEEEEEEEEEEEccTTGGGcc############## DISOP:02AL 574-576| PSIPRED ccHHHHHHHHHHcccccHHHHHHHHHccccHHHHHHcccccccccccccEEEccccccHHHHHHHHHHHHHHHHHHHHcccccccccEEEEEcccccHHHHHHHHHHHHHHcccEEEEEcccccHHHHHHHHHHccccEEEEEEccccccccccEEEEccccccccHHHHHHHHHHHHHHHcccccccccHHHccccccEEEccHHHHHHHHHHHHHHcccHHHHHccccccEEEEEcccccHHHHHHHHHHHcccccEEEEccccccccccccccccccccccHHHHHHHHHHHHcccEEEEEccccccEEEEEEcccccEEEEEHHHHHHHHHHHHHHHcHHccccccccEEEEEcccHHHHHHHHHHcccEEEEEccccHHHHHHHHHHHHcccccEEEEEEccccEEccccccccHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHccccccEEEEEEccccHHHHHHHHHHHHHHHHcHHHHcccEEEEEEEccccccccccccccccccccccEEEEEEcccEEEEEEccccccEEEEEEEcccccHHHHHHHHHHHHHHHHHHHcc //