[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : glnP.1
DDBJ      :glnP         Glutamine-binding protein / Glutamine transport system permease protein
Swiss-Prot:             

Homologs  Archaea  33/68 : Bacteria  725/915 : Eukaryota  6/199 : Viruses  0/175   --->[See Alignment]
c.94.1f.58.1
:485 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   36->250 1wdnA PDBj 5e-33 38.9 %
:BLT:PDB   282->426 3dhwA PDBj 8e-09 25.2 %
:RPS:PDB   32->255 3delB PDBj 1e-43 25.0 %
:RPS:PDB   346->425 3dhwA PDBj 3e-11 25.3 %
:RPS:SCOP  29->263 1xt8A1  c.94.1.1 * 9e-43 25.9 %
:RPS:SCOP  283->484 2r6gG1  f.58.1.1 * 1e-29 17.8 %
:HMM:SCOP  1->256 2a5sA1 c.94.1.1 * 1.1e-66 37.5 %
:RPS:PFM   36->250 PF00497 * SBP_bac_3 5e-34 37.4 %
:RPS:PFM   326->436 PF00528 * BPD_transp_1 3e-06 28.2 %
:HMM:PFM   35->252 PF00497 * SBP_bac_3 1.9e-61 34.6 217/225  
:HMM:PFM   302->484 PF00528 * BPD_transp_1 3.1e-24 19.6 179/185  
:BLT:SWISS 28->250 GLNH_ECOLI 4e-33 38.4 %
:BLT:SWISS 273->483 GLNM_BACSU 4e-32 31.9 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABD98883.1 GT:GENE glnP.1 GT:PRODUCT Glutamine-binding protein / Glutamine transport system permease protein GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION complement(70946..72403) GB:FROM 70946 GB:TO 72403 GB:DIRECTION - GB:GENE glnP GB:PRODUCT Glutamine-binding protein / Glutamine transport system permease protein GB:NOTE COG0834 [ET] ABC-type amino acid transport/signal transduction systems, periplasmic component/domain GB:PROTEIN_ID ABD98883.1 GB:DB_XREF GI:90820244 GB:GENE:GENE glnP LENGTH 485 SQ:AASEQ MLKKAFIFIVSCLCTLLIFTNLNNNHVNADTKTYNIGTDVTYPPFEFANKNNQYVGIDIDLMKAIAKEEGFKVNIQPIGFNSAVQSLQSGQIDGVIAGMAITDERKQKFDFSKPYYKTGFIMTVAKNSNITSLKQLRGKRVALKTGTAAANYALSLKDKYGFKTVTFDDSDNMYNDVVNGNSVACFEDMPVMQYAIQTGTKLKIVTKPAQSGYYGFAVMKGKNQELLHKFDDGLAKLKKNGGYDKIVNRYINQNTIAEQKKANENSNNEHTFIGLLKQNSGVFLNGLWKTIYLTILGIIGATIFGIVIGFLGVIPNKFAQGISTTVIYIFRGLPLLVLALFIYNGIPSLTGTKIPAFIAGIITLTLNEGAYTAAFVKGGIEAVDKGQMEAARSLGLSFGKAMKKIILPQGIKIMVPSFVNQFIITLKDTSILSIIGILELTQTGKIIIARNLEGFKVWAIIGLMYLIVITVLTWISNYLQKKMNS GT:EXON 1|1-485:0| BL:SWS:NREP 2 BL:SWS:REP 28->250|GLNH_ECOLI|4e-33|38.4|216/248| BL:SWS:REP 273->483|GLNM_BACSU|4e-32|31.9|210/216| TM:NTM 6 TM:REGION 5->25| TM:REGION 291->313| TM:REGION 322->344| TM:REGION 357->379| TM:REGION 405->427| TM:REGION 454->476| SEG 303->314|ifgivigflgvi| BL:PDB:NREP 2 BL:PDB:REP 36->250|1wdnA|5e-33|38.9|208/223| BL:PDB:REP 282->426|3dhwA|8e-09|25.2|139/203| RP:PDB:NREP 2 RP:PDB:REP 32->255|3delB|1e-43|25.0|220/232| RP:PDB:REP 346->425|3dhwA|3e-11|25.3|75/203| RP:PFM:NREP 2 RP:PFM:REP 36->250|PF00497|5e-34|37.4|211/222|SBP_bac_3| RP:PFM:REP 326->436|PF00528|3e-06|28.2|110/195|BPD_transp_1| HM:PFM:NREP 2 HM:PFM:REP 35->252|PF00497|1.9e-61|34.6|217/225|SBP_bac_3| HM:PFM:REP 302->484|PF00528|3.1e-24|19.6|179/185|BPD_transp_1| GO:PFM:NREP 6 GO:PFM GO:0005215|"GO:transporter activity"|PF00497|IPR001638| GO:PFM GO:0006810|"GO:transport"|PF00497|IPR001638| GO:PFM GO:0030288|"GO:outer membrane-bounded periplasmic space"|PF00497|IPR001638| GO:PFM GO:0005215|"GO:transporter activity"|PF00528|IPR000515| GO:PFM GO:0006810|"GO:transport"|PF00528|IPR000515| GO:PFM GO:0016020|"GO:membrane"|PF00528|IPR000515| RP:SCP:NREP 2 RP:SCP:REP 29->263|1xt8A1|9e-43|25.9|232/248|c.94.1.1| RP:SCP:REP 283->484|2r6gG1|1e-29|17.8|202/284|f.58.1.1| HM:SCP:REP 1->256|2a5sA1|1.1e-66|37.5|253/0|c.94.1.1|1/1|Periplasmic binding protein-like II| OP:NHOMO 7341 OP:NHOMOORG 764 OP:PATTERN 22--13----------2-3333326--32-3322----769B313335-11-2----3------3--- ----6523444422411----8--1J------A9995AFE26329394455-DAE349--2231B8AG6C4D999CAA42742--------------------------12222222333333311-1-2--7---333552222-12472234433-11-1--11-3342-1112--2112-3782244--4B799999FC99BB99B9465FE99B655B987777774IA333333333333333333358B7BDCDE89BAA99DC4A7AI7444DDDC9997GGDEDDDDEDCDD99987999999999DDLIHDDDD37B9GAC8BAAB464797745554432173362GG-9153-32222233E1--22237645633Q89233423338AD997ECCEj-22K22F1DJR24*eeacedifxXZVE---47SA8AC47E1111111144511-4B----------222211122222221--2-5--21-9OKGOdeefhbIGLLKUUUkMLMMGLcStBCD612FEHB7A76EDPMUX246---1I87744444---24-34T2FGFL9CLGGF88189172-122-31--A-9878888886555454555-35----GIG-5-----G-3333--23333322-32-4-7-2--------JIYZDMKGGGFGGCGGF-GGIGGGGFGGGGGEGGEEIVdSbYBB9IFHEHIIIIIIIIIFHRFFDFEFF62MHIIIIHHHIII--81333337666--9FL77794954334555399999-96A951NKKNQfVdHMQJK7TQR--111111--AAAGDDDDDEEEAA11---------------9--------------115527----------------------263-238323-11 --------------------------------------------------------------------------------------------------------------------------------------------------------------2----2------7--1-----------1--2---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 424 STR:RPRED 87.4 SQ:SECSTR ##EEEEEEcccTTTcEEEEccTTTccccTTccEEEEEEccccTTTcEEcTTccEEcHHHHHHHHHHHHHTcEEEEEEccGGGHHHHHHTTcccEEcccccccHHHHTTEEEEEEEEEEEcEEEEEEccccccccGGGcccEEEETTcHHHHHHHHHHHcTTccEEEEccHHHHHHHHHTTcccEEEEcHHHHHHHGGGEEEEEEccGGGcEEEEEEEEETTTcHHHHHHHHHHHHHHHHTTHHHHHHHHTTGGGcccEEEcGGGTHccHcEEE########HHHHHHHHHHHHHHTTGGGGGGGGGGTTccccccccHHHHHHH#HHHHHHHccHHHHHHHHHHHHHHTTcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccTTTTTHHHHHTccTHHHHHHTTHHHHHHHHHHHHHHHHHHHHTccHHHHHH################################################## DISOP:02AL 1-1,485-486| PSIPRED ccHHHHHHHHHHHHHHHHHHHcccccHHHHccEEEEEEEccccccEEEcccccEEEEHHHHHHHHHHHcccEEEEEEccHHHHHHHHHcccEEEEEEcccccHHHHHHHHHccccEEccEEEEEEcccccccHHHHcccEEEEEcccHHHHHHHHHccccccEEEEEccHHHHHHHHHcccccEEEEcHHHHHHHHHccccEEEEccccccccEEEEEEccccHHHHHHHHHHHHHHHHcccHHHHHHHHccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc //