[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : glnP.3
DDBJ      :glnP         Glutamine transport system permease protein
Swiss-Prot:             

Homologs  Archaea  30/68 : Bacteria  700/915 : Eukaryota  4/199 : Viruses  0/175   --->[See Alignment]
f.58.1
:217 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   52->157 3dhwA PDBj 3e-07 24.8 %
:RPS:PDB   115->155 3dhwA PDBj 1e-08 35.1 %
:RPS:SCOP  4->216 2r6gG1  f.58.1.1 * 6e-26 12.2 %
:RPS:PFM   89->167 PF00528 * BPD_transp_1 4e-04 27.8 %
:HMM:PFM   36->215 PF00528 * BPD_transp_1 5.8e-23 19.9 176/185  
:HMM:PFM   3->44 PF06396 * AGTRAP 0.00058 26.2 42/162  
:BLT:SWISS 4->215 GLNP_BACSU 1e-44 51.9 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE00247.1 GT:GENE glnP.3 GT:PRODUCT Glutamine transport system permease protein GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION complement(1502887..1503540) GB:FROM 1502887 GB:TO 1503540 GB:DIRECTION - GB:GENE glnP GB:PRODUCT Glutamine transport system permease protein GB:NOTE COG0765 [E] ABC-type amino acid transport system, permease component GB:PROTEIN_ID ABE00247.1 GB:DB_XREF GI:90821608 GB:GENE:GENE glnP LENGTH 217 SQ:AASEQ MSTFEQAYSWINLRFLLEGLWVTLEVSVISIVLSFIIGLILGVIRYVKIKYLSAAVGFLIDIIRNLPLLLIIFFTYFGLPELGLRMTPMLAAVTALVVFESAMLAEIVRSGIQAVPVGQMEGARSSGLTYVQAMWHIIMPQALQKMIPPLVSQFISLVKDTSLATIIVLPELLYHAQIIYSQNTTYMVPMYLMIAVMYFIVCYCLSLVARRLEKRYG GT:EXON 1|1-217:0| BL:SWS:NREP 1 BL:SWS:REP 4->215|GLNP_BACSU|1e-44|51.9|212/218| TM:NTM 5 TM:REGION 18->40| TM:REGION 54->76| TM:REGION 124->146| TM:REGION 151->173| TM:REGION 188->209| SEG 26->44|vsvisivlsfiiglilgvi| BL:PDB:NREP 1 BL:PDB:REP 52->157|3dhwA|3e-07|24.8|105/203| RP:PDB:NREP 1 RP:PDB:REP 115->155|3dhwA|1e-08|35.1|37/203| RP:PFM:NREP 1 RP:PFM:REP 89->167|PF00528|4e-04|27.8|79/195|BPD_transp_1| HM:PFM:NREP 2 HM:PFM:REP 36->215|PF00528|5.8e-23|19.9|176/185|BPD_transp_1| HM:PFM:REP 3->44|PF06396|0.00058|26.2|42/162|AGTRAP| GO:PFM:NREP 3 GO:PFM GO:0005215|"GO:transporter activity"|PF00528|IPR000515| GO:PFM GO:0006810|"GO:transport"|PF00528|IPR000515| GO:PFM GO:0016020|"GO:membrane"|PF00528|IPR000515| RP:SCP:NREP 1 RP:SCP:REP 4->216|2r6gG1|6e-26|12.2|213/284|f.58.1.1| OP:NHOMO 4403 OP:NHOMOORG 734 OP:PATTERN 11--12----------1-1111114--21-2211----1122--2222--1-1----2------2--- ----4313333321411----6--1D------766636C914225283533-769135--2221577B5A3755576631421---------------------------11111111111111-----1--4---222341111-2234223332221111--1--3322-2212--2212-1341111--27455555875566556623398556333754355555396222222222222222222246657AB885676666B93757D533388886665AA999878999986666566666666778BA98888135575645455232344423333122142331AA-4132-1111111171--11137444422M68222422222375347567Q-22H22D29EJ23qTTORWUVUgMNPA---25K757934B1111111134511-39----------111111111111111--1-5--21-6IGCHJKKJMHA7AAADDHVBBBB9AGGZ77B412B9C93854B9HEMP244----944422222---25-11L-997C56CAAA42-23-3----------6-4441666663342322222-13----889-2-----C-1111--11111111-11-2---1--------A9MK7BD8888887887-88A8888888888788779FLDML7768685888888888868E776777732EBBBBBA9BBBB--5-222221111--68E44452523223233155555-54554-ECEEHOJRAHIDF5NKL----------6679888889997711---------------2----------------3526----------------------132-115111--1 --------------------------------------------------------------------------------------------------------------------------------------------------------------2----2------6-----------------2---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 105 STR:RPRED 48.4 SQ:SECSTR ###################################################HHHHHHHHHHHHHHccHHHHHHHHHHHHHTTccccc#HHHHHHHHHHHHHHHHHHHHHHHHHHccTTTTTHHHHHTccTHHHHHHTTHHHHHHHHHHHHHHHHHHH############################################################ PSIPRED cccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHcHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHc //