[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : glnR
DDBJ      :glnR         Glutamine synthetase repressor
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  122/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.6.1
:128 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   18->71 1q06B PDBj 7e-05 35.2 %
:RPS:PDB   12->77 3d70A PDBj 7e-11 25.8 %
:RPS:SCOP  15->103 1jbgA  a.6.1.3 * 5e-10 19.1 %
:HMM:SCOP  12->105 1jbgA_ a.6.1.3 * 9.8e-16 28.6 %
:RPS:PFM   15->50 PF00376 * MerR 6e-05 47.2 %
:HMM:PFM   15->50 PF00376 * MerR 1.3e-13 44.4 36/38  
:HMM:PFM   42->115 PF05023 * Phytochelatin 0.00098 16.7 72/213  
:BLT:SWISS 6->120 GLNR_BACSU 4e-26 48.2 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABD99366.1 GT:GENE glnR GT:PRODUCT Glutamine synthetase repressor GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION 597020..597406 GB:FROM 597020 GB:TO 597406 GB:DIRECTION + GB:GENE glnR GB:PRODUCT Glutamine synthetase repressor GB:NOTE COG0640 [K] Predicted transcriptional regulators GB:PROTEIN_ID ABD99366.1 GB:DB_XREF GI:90820727 GB:GENE:GENE glnR LENGTH 128 SQ:AASEQ MREKELRRSLAVLPMGTVMKLTNLTARQIRYYEEQELVIPERNAGNRRMYSLNDIDKLLEIKDFLGEGINMAGIKHIYEEKAKKEQEKADKHNTLTDADVRRILRDEFVSAGGFMKDNDFSLRNNRSL GT:EXON 1|1-128:0| BL:SWS:NREP 1 BL:SWS:REP 6->120|GLNR_BACSU|4e-26|48.2|114/135| SEG 79->89|eekakkeqeka| BL:PDB:NREP 1 BL:PDB:REP 18->71|1q06B|7e-05|35.2|54/126| RP:PDB:NREP 1 RP:PDB:REP 12->77|3d70A|7e-11|25.8|66/276| RP:PFM:NREP 1 RP:PFM:REP 15->50|PF00376|6e-05|47.2|36/37|MerR| HM:PFM:NREP 2 HM:PFM:REP 15->50|PF00376|1.3e-13|44.4|36/38|MerR| HM:PFM:REP 42->115|PF05023|0.00098|16.7|72/213|Phytochelatin| GO:PFM:NREP 2 GO:PFM GO:0003700|"GO:transcription factor activity"|PF00376|IPR000551| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF00376|IPR000551| RP:SCP:NREP 1 RP:SCP:REP 15->103|1jbgA|5e-10|19.1|89/106|a.6.1.3| HM:SCP:REP 12->105|1jbgA_|9.8e-16|28.6|91/106|a.6.1.3|1/1|Putative DNA-binding domain| OP:NHOMO 133 OP:NHOMOORG 122 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------1-------------------------------------------------------------------------------------------------------------122111111111111111112222111112122211111112111111111111111111111-1-11-----11--111111111111111-111111111111111111111111111111-11111111---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 67 STR:RPRED 52.3 SQ:SECSTR ##########ccEEHHHHHHHHTccHHHHHHHHHTTccccEcTTTccEEEcGGGGGHHHHHHHHHHHTccHHHHHHH################################################### DISOP:02AL 1-12,79-97,122-129| PSIPRED ccccHHHcccccccHHHHHHHHcccHHHHHHHHHcccccccccccccEEccHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHcccccccccccccc //