[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : gloA
DDBJ      :gloA         Glyoxalase family protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  212/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
d.32.1
:126 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   3->126 2p25A PDBj 7e-29 45.5 %
:RPS:PDB   4->126 2a4xA PDBj 7e-17 15.4 %
:RPS:SCOP  5->126 1f9zA  d.32.1.1 * 8e-16 24.6 %
:HMM:SCOP  1->127 1sp8A2 d.32.1.3 * 6e-26 29.1 %
:RPS:PFM   5->123 PF00903 * Glyoxalase 6e-07 29.1 %
:HMM:PFM   5->124 PF00903 * Glyoxalase 1.1e-19 24.2 120/128  
:BLT:SWISS 1->126 YWKD_BACSU 5e-30 48.4 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABD98901.1 GT:GENE gloA GT:PRODUCT Glyoxalase family protein GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION 100015..100395 GB:FROM 100015 GB:TO 100395 GB:DIRECTION + GB:GENE gloA GB:PRODUCT Glyoxalase family protein GB:NOTE COG0346 [E] Lactoylglutathione lyase and related lyases GB:PROTEIN_ID ABD98901.1 GB:DB_XREF GI:90820262 GB:GENE:GENE gloA LENGTH 126 SQ:AASEQ MDFSKVHHIAIIGTDFEEMKEFYVDKLGFTLLDKHVRPEKNDILFNVGFGEMVLEIFIKEDAPVRPTYPEAKGLRHLAFRVDSVEETVKELTAKGVECEPIRNDTFNGKAMTFFYDPAGTPLEIHE GT:EXON 1|1-126:0| BL:SWS:NREP 1 BL:SWS:REP 1->126|YWKD_BACSU|5e-30|48.4|126/128| BL:PDB:NREP 1 BL:PDB:REP 3->126|2p25A|7e-29|45.5|123/124| RP:PDB:NREP 1 RP:PDB:REP 4->126|2a4xA|7e-17|15.4|123/131| RP:PFM:NREP 1 RP:PFM:REP 5->123|PF00903|6e-07|29.1|117/120|Glyoxalase| HM:PFM:NREP 1 HM:PFM:REP 5->124|PF00903|1.1e-19|24.2|120/128|Glyoxalase| RP:SCP:NREP 1 RP:SCP:REP 5->126|1f9zA|8e-16|24.6|122/128|d.32.1.1| HM:SCP:REP 1->127|1sp8A2|6e-26|29.1|127/0|d.32.1.3|1/1|Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase| OP:NHOMO 213 OP:NHOMOORG 213 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------1----------1---111------------------------------------------11---------------111-----------------------111111111-111111--11-1111111--------------------------------1-----------------11---1111111111111-----------11111111111111111111111---11-------1-1-----111-------1-----------------------------------------------------------------1----------------1---------------------11------------------------------------------------------------------------------1-----1-------------------------------------------------------------------------------------11-1-11-111-1111-1-111--1------------------11111111111111111-111111111111111111111111--1111111111111111111111111--111111111111---------------1-11111-1--------1----------11-------------1----------------111111-11111111111--1----------------------------------------------------1---------- --------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 126 STR:RPRED 100.0 SQ:SECSTR TTTccccEEEEEEccHHHHHHHHHTTTccccGGGGGccEEEEEcTTccEEEEEEHHHHHHHTccccccccccEEEEEcccHHHHHHHHHHHHHTTccEEEEEEEETTTEEEEEEEcTTccEEEEEE DISOP:02AL 1-1| PSIPRED ccccEEEEEEEEEccHHHHHHHHHHHHccEEEEEEEcccccEEEEEEcccccEEEEEEcccccccccccccccEEEEEEEEccHHHHHHHHHHcccEEEEEEcccccccEEEEEEcccccEEEEEc //