[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : glpF.3
DDBJ      :glpF         Glycerol uptake facilitator protein
Swiss-Prot:             

Homologs  Archaea  22/68 : Bacteria  485/915 : Eukaryota  160/199 : Viruses  0/175   --->[See Alignment]
f.19.1
:235 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   4->226 3c02A PDBj 5e-25 34.6 %
:RPS:PDB   62->234 2b5fD PDBj 3e-22 22.3 %
:RPS:SCOP  5->235 1fx8A  f.19.1.1 * 5e-39 36.6 %
:HMM:SCOP  1->237 1fx8A_ f.19.1.1 * 2.9e-54 41.6 %
:RPS:PFM   1->228 PF00230 * MIP 4e-37 48.1 %
:HMM:PFM   4->228 PF00230 * MIP 1.1e-43 34.7 202/227  
:BLT:SWISS 1->230 GLPF_THEMA 1e-54 45.6 %
:PROS 63->71|PS00221|MIP
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE00432.1 GT:GENE glpF.3 GT:PRODUCT Glycerol uptake facilitator protein GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION complement(1717950..1718657) GB:FROM 1717950 GB:TO 1718657 GB:DIRECTION - GB:GENE glpF GB:PRODUCT Glycerol uptake facilitator protein GB:NOTE COG0580 [G] Glycerol uptake facilitator and related permeases (Major Intrinsic Protein Family) GB:PROTEIN_ID ABE00432.1 GB:DB_XREF GI:90821793 GB:GENE:GENE glpF LENGTH 235 SQ:AASEQ MNGFIGEFLGTMILIVLGVGTGAGINLKTSYARNAGWLFVTLAWGMAVTFGVYVAGSFGAQGHLNPAVTIGFALFGFFPWSQVLPYLLGQFLGAFVGAVLVIIQYGAQFKNAKNTSDGNVVGIFATGPAIDNGLYNFLSETIATFVFIFTLLNLGDFTKGLKPLIVGLLIMVVGQALGGTTGFALNPARDWAPRFAYTVLPVPNKSNANWGYAWVPMLGPIVGGILAAGLQYLLV GT:EXON 1|1-235:0| BL:SWS:NREP 1 BL:SWS:REP 1->230|GLPF_THEMA|1e-54|45.6|226/234| PROS 63->71|PS00221|MIP|PDOC00193| TM:NTM 6 TM:REGION 4->26| TM:REGION 35->57| TM:REGION 61->83| TM:REGION 86->108| TM:REGION 150->172| TM:REGION 213->235| BL:PDB:NREP 1 BL:PDB:REP 4->226|3c02A|5e-25|34.6|211/242| RP:PDB:NREP 1 RP:PDB:REP 62->234|2b5fD|3e-22|22.3|157/230| RP:PFM:NREP 1 RP:PFM:REP 1->228|PF00230|4e-37|48.1|214/227|MIP| HM:PFM:NREP 1 HM:PFM:REP 4->228|PF00230|1.1e-43|34.7|202/227|MIP| GO:PFM:NREP 3 GO:PFM GO:0005215|"GO:transporter activity"|PF00230|IPR000425| GO:PFM GO:0006810|"GO:transport"|PF00230|IPR000425| GO:PFM GO:0016020|"GO:membrane"|PF00230|IPR000425| RP:SCP:NREP 1 RP:SCP:REP 5->235|1fx8A|5e-39|36.6|227/254|f.19.1.1| HM:SCP:REP 1->237|1fx8A_|2.9e-54|41.6|233/254|f.19.1.1|1/1|Aquaporin-like| OP:NHOMO 1477 OP:NHOMOORG 667 OP:PATTERN -------1-111111------------1----111---1111111111---1---------------- 1121211-----1-2----------3-------111-1------11111111111112--11-11-2322-1111111----1----------1----------11-1-2--------------111---------11111----1----1------------11-1----------------111----1--111111111111111111111111111111212222221-111111111111111111133221221111155112243422144333331123113333333333323223222322323331113333---211111111212----2222-1-11---1----1----1-211--1-2-2---------3-1-------1----------------1--1-11-------11------11-1-1--1111---111111111221------------------------------------11------22222212222222-222222222---1----------1---1--1--1--2---------------------1-11111-1-11--------1-----------------------------112221-----1------------1----1----1-------11122111111111111121-1111121111112111111333112212222222222222212111111121-211111111111------------------111212112-21--1111111----2-11111111-22211111111111111-2112-1111221111111111---1111---111111111111111---------1-1111111111111-----------1----- 11--1---313-12167343123333311-1-1111111111111144232222332--11-2-1212--21-1-22-121--------5227115111-2-2122-23-ABC9AA41335543B44A4Ca7-859335462565242325324665771114866-1-3B5A51-11-----22FFXU1RC1-OITW1 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 235 STR:RPRED 100.0 SQ:SECSTR HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccTTcHHHHHHHHHHHHHHHHHHcTTTcccccccHHHHHHHHTTTcccHHHHHHHHHHHHHHHHHHHHHHHHHccHHHTTTcTHHHHHHcGGGcccccTTccHHHHHHHHHHHHHHHHHHHHHTEcccEEccHHHHHHHHHHHHHHTTTTcccccHHHHHHHHHHHHHHHcTHccHHHHHHTTHHHHHHHHHHHHHHHHHHHcT PSIPRED cHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccEEEEEccccccccHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHcccccccccccccEEHHHHHHHHHHHHHHHHHHHHc //