[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : gltP
DDBJ      :gltP         Proton/sodium-glutamate symport protein
Swiss-Prot:             

Homologs  Archaea  20/68 : Bacteria  655/915 : Eukaryota  103/199 : Viruses  0/175   --->[See Alignment]
f.49.1
:425 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   138->407 1xfhA PDBj 2e-53 38.9 %
:RPS:SCOP  85->407 1xfhA  f.49.1.1 * 3e-78 34.9 %
:HMM:SCOP  11->407 2nwwA1 f.49.1.1 * 1.4e-113 42.0 %
:RPS:PFM   85->406 PF00375 * SDF 4e-53 44.1 %
:HMM:PFM   11->405 PF00375 * SDF 1.3e-121 43.9 387/390  
:BLT:SWISS 95->423 GLTT_BACST e-101 52.6 %
:PROS 301->324|PS00714|NA_DICARBOXYL_SYMP_2
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABD99948.1 GT:GENE gltP GT:PRODUCT Proton/sodium-glutamate symport protein GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION 1173980..1175257 GB:FROM 1173980 GB:TO 1175257 GB:DIRECTION + GB:GENE gltP GB:PRODUCT Proton/sodium-glutamate symport protein GB:NOTE COG1301 [C] Na+/H+-dicarboxylate symporters GB:PROTEIN_ID ABD99948.1 GB:DB_XREF GI:90821309 GB:GENE:GENE gltP LENGTH 425 SQ:AASEQ MKKNKVFRLSLGWQIILGLVIGVILGVVFADNKKFIAFANGLGSTFINMISMIVLPIVVSSLIVGISNMGDIKKLGKIGLKTLIYFEVLSTIAFIVGMVISNFSHLGYMLDLSQLSHVDISTYVKTAKSAAHNGLGSILMSIVPSNFFDALATGQMLPVIFFSSLFGLGIAAIGEKGKILITFLQAVAEVMFKITGWIMHFAPFGVAGLIGATVAQLGLASLKPLALFIVMAYITMIFFILVVLGITSRIFGFRIMDQLIVVKDELILAFTTASSEVTLPRLMQKTQKLGVDQAISSFVIPTGYTFNLDGSAIYQSLAAIFLAQAYHVHLSISQQITLLLVLMITSKGMAGVPGASFVVLLATVSSIGVPVSGLALIAGIDRLVDMGRTAVNVAGNVTATLVIGKSENEFDQVKHDAYVASFRNK GT:EXON 1|1-425:0| BL:SWS:NREP 1 BL:SWS:REP 95->423|GLTT_BACST|e-101|52.6|329/421| PROS 301->324|PS00714|NA_DICARBOXYL_SYMP_2|PDOC00591| TM:NTM 8 TM:REGION 7->29| TM:REGION 42->64| TM:REGION 80->102| TM:REGION 152->174| TM:REGION 187->209| TM:REGION 227->249| TM:REGION 329->351| TM:REGION 358->380| SEG 11->28|lgwqiilglvigvilgvv| SEG 49->67|mismivlpivvsslivgis| SEG 70->84|gdikklgkiglktli| BL:PDB:NREP 1 BL:PDB:REP 138->407|1xfhA|2e-53|38.9|270/405| RP:PFM:NREP 1 RP:PFM:REP 85->406|PF00375|4e-53|44.1|315/392|SDF| HM:PFM:NREP 1 HM:PFM:REP 11->405|PF00375|1.3e-121|43.9|387/390|SDF| GO:PFM:NREP 3 GO:PFM GO:0006835|"GO:dicarboxylic acid transport"|PF00375|IPR001991| GO:PFM GO:0016020|"GO:membrane"|PF00375|IPR001991| GO:PFM GO:0017153|"GO:sodium:dicarboxylate symporter activity"|PF00375|IPR001991| RP:SCP:NREP 1 RP:SCP:REP 85->407|1xfhA|3e-78|34.9|315/405|f.49.1.1| HM:SCP:REP 11->407|2nwwA1|1.4e-113|42.0|388/0|f.49.1.1|1/1|Proton glutamate symport protein| OP:NHOMO 2265 OP:NHOMOORG 778 OP:PATTERN 111-1-------------------111---2--------------1---11-1-1111112------1 -12-112133323-2--11-11--1211111-12221364-1-11111-111345221--11--216122-----1---222-1-1--1111----1--213112412121111111211222221----1---11-------------2---------1------1111--1-----1----122------145575655656666663144546653254321------31322222222222222322243-1-11-1111111111211------11111111---1111-11---1111111111111-11111111--23142222212324-1--222211-53-1---1-11---1--111--113-133331111131953---2111-----------1-3364373512-232211132111142111--3-------21222222-11111-1--111111--1111111111111111111-224312----C8879B445532257444434533345512334113114212421111111251111111111--3--2-1---123---1111---1-12212311-12331333331---------12-1---552312121214666644866656587575---1---------54444433443333334-4423433343434333334444552214444444454344444333233331-4333333333331111-----222211-13111-21-222211128888838223423343357714467233222222222213555333326454433333333333333---5111111---1-11-2-1----1-------------------------------1- --------------111111-------111111-----------------11111211----------------------------------1----------2-1--117EMEDD775447A6FH3A6Hr7-A7F4646A667827747713F4987847C2B812434C6663-1117----22--11-22-9486- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 270 STR:RPRED 63.5 SQ:SECSTR #########################################################################################################################################HHGGGccccHHHHHTTccTTHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTccHHHHHHHHHHHHHHHHGGGccHHHHHHHHHHHHHHHHHHHHHHHHHHHTTcccHHHHHHHTHHHHHHHHHHccHHHHHHHHHHHHHTTTccTTTHHHHcGGGTTTccHHHHHHHHHHHHHHHHHTTccTTTTTTHHHHHHHHHHHHHccccTTTTTTTTHHHHHHHTccTHHHHHHTTcHHHHHHHHTTHHHHHHHHHHHHHHHcc################## DISOP:02AL 1-4,116-132,421-426| PSIPRED cccccEEEEEHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHccccccccccHHHHHHHHccccHHHHHHccccHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccc //