[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : glyQ
DDBJ      :glyQ         Glycyl-tRNA synthetase alpha chain
Swiss-Prot:SYGA_LACS1   RecName: Full=Glycyl-tRNA synthetase alpha subunit;         EC=6.1.1.14;AltName: Full=Glycine--tRNA ligase alpha subunit;         Short=GlyRS;

Homologs  Archaea  0/68 : Bacteria  671/915 : Eukaryota  17/199 : Viruses  0/175   --->[See Alignment]
d.104.1
:305 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   7->280 1j5wB PDBj 1e-87 58.1 %
:RPS:PDB   110->291 2du7A PDBj 5e-14 13.8 %
:RPS:SCOP  7->284 1j5wA  d.104.1.1 * e-135 58.2 %
:HMM:SCOP  5->285 1j5wA_ d.104.1.1 * 2.3e-136 65.1 %
:RPS:PFM   8->289 PF02091 * tRNA-synt_2e e-123 68.1 %
:HMM:PFM   7->290 PF02091 * tRNA-synt_2e 1.8e-154 66.9 284/284  
:BLT:SWISS 1->291 SYGA_LACS1 e-174 100.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABD99722.1 GT:GENE glyQ GT:PRODUCT Glycyl-tRNA synthetase alpha chain GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION complement(938001..938918) GB:FROM 938001 GB:TO 938918 GB:DIRECTION - GB:GENE glyQ GB:PRODUCT Glycyl-tRNA synthetase alpha chain GB:NOTE COG0752 [J] Glycyl-tRNA synthetase, alpha subunit GB:PROTEIN_ID ABD99722.1 GB:DB_XREF GI:90821083 GB:GENE:GENE glyQ LENGTH 305 SQ:AASEQ MTKKLALQDIILTLQQFWAKQGCMLMQSYDTEKGAGTMSPYTFLRAIGPEPWNVAYVEPSRRPADGRYGDNPNRLYQHHQFQVLMKPSPSNIQELYLDSLRALGIEPKEHDIRFVEDNWENPSMGCAGVGWEVWLDGMEITQFTYFQQVGGLEVKPVAAEVTYGLERLSSYIQDVDSVYDLEWADGVKYGDIFKEPEYEHSKYSFEESNQEMLLNLFDTFETEAKKQLANGLVHPAYDYILKCSHTFNLLDARGAVSVTERAGYLSRIRNMAKSVAKVFVAERKKLGYPLIKDEKLRQELLKEEK GT:EXON 1|1-305:0| SW:ID SYGA_LACS1 SW:DE RecName: Full=Glycyl-tRNA synthetase alpha subunit; EC=6.1.1.14;AltName: Full=Glycine--tRNA ligase alpha subunit; Short=GlyRS; SW:GN Name=glyQ; OrderedLocusNames=LSL_0912; SW:KW Aminoacyl-tRNA synthetase; ATP-binding; Complete proteome; Cytoplasm;Ligase; Nucleotide-binding; Protein biosynthesis. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->291|SYGA_LACS1|e-174|100.0|291/305| GO:SWS:NREP 6 GO:SWS GO:0004812|"GO:aminoacyl-tRNA ligase activity"|Aminoacyl-tRNA synthetase| GO:SWS GO:0005524|"GO:ATP binding"|ATP-binding| GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0016874|"GO:ligase activity"|Ligase| GO:SWS GO:0000166|"GO:nucleotide binding"|Nucleotide-binding| GO:SWS GO:0006412|"GO:translation"|Protein biosynthesis| SEG 292->304|kdeklrqellkee| BL:PDB:NREP 1 BL:PDB:REP 7->280|1j5wB|1e-87|58.1|267/272| RP:PDB:NREP 1 RP:PDB:REP 110->291|2du7A|5e-14|13.8|167/539| RP:PFM:NREP 1 RP:PFM:REP 8->289|PF02091|e-123|68.1|282/284|tRNA-synt_2e| HM:PFM:NREP 1 HM:PFM:REP 7->290|PF02091|1.8e-154|66.9|284/284|tRNA-synt_2e| GO:PFM:NREP 6 GO:PFM GO:0000166|"GO:nucleotide binding"|PF02091|IPR002310| GO:PFM GO:0004820|"GO:glycine-tRNA ligase activity"|PF02091|IPR002310| GO:PFM GO:0005524|"GO:ATP binding"|PF02091|IPR002310| GO:PFM GO:0005737|"GO:cytoplasm"|PF02091|IPR002310| GO:PFM GO:0006412|"GO:translation"|PF02091|IPR002310| GO:PFM GO:0006426|"GO:glycyl-tRNA aminoacylation"|PF02091|IPR002310| RP:SCP:NREP 1 RP:SCP:REP 7->284|1j5wA|e-135|58.2|273/276|d.104.1.1| HM:SCP:REP 5->285|1j5wA_|2.3e-136|65.1|281/281|d.104.1.1|1/1|Class II aaRS and biotin synthetases| OP:NHOMO 699 OP:NHOMOORG 688 OP:PATTERN -------------------------------------------------------------------- 111--------------------------------------111--------------111---1-------------1111-11111----------------------111111111111111---------------------1112111111111111111111111111111111111-----111--1---------------111111-------11111111111--------------------1111111111111111111111111111111111111111111111111111111111111111111111----------------1---------1-1--111111111111----111-1-111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111121111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11-1111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111------------------------------------------1111111111--- -------------------------------------------------------------------------------------------------------------------------------------------------------------------1------2----11117111111111-2-------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 283 STR:RPRED 92.8 SQ:SECSTR ######HHHHH#HHHHHHHTTTcEEccccc#ccccGGGcHHHHTGGGccccEEEEEEEEEEcGGGccTTcccccccEEEEEEEEEEcccTTHHHHHHHHHHHHTccTcccTTTcEEEEEccccccEEEccEEEEEEEEccHHHHHHEEcTTccccEEEEEEcHEHHHHHHHHTTccccHHHHccccccccccHHHHHHTTcccccccccHHHHHHHHHHHHHHccccccccccccccHHHHcccccccccccccEEccccccHHTTccccccccccccEEETTEEcccccc############## DISOP:02AL 1-4,302-306| PSIPRED ccccccHHHHHHHHHHHHHHcccEEEEccccccccccccHHHHHHHcccccccccccccccccccccccccccHHHHHEEEEEEEccccccHHHHHHHHHHHHcccHHHccccEEEccccccccccccccEEEEEccEEEEEEEEHHHcccccccccccHHHHHHHHHHHHHcccccHHHHHHccccccHHHcccccHHHHHHccccccHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHcc //