[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : gpsA
DDBJ      :gpsA         Glycerol-3-phosphate dehydrogenase (NAD(P)+)
Swiss-Prot:GPDA_LACS1   RecName: Full=Glycerol-3-phosphate dehydrogenase [NAD(P)+];         EC=1.1.1.94;AltName: Full=NAD(P)H-dependent glycerol-3-phosphate dehydrogenase;

Homologs  Archaea  4/68 : Bacteria  859/915 : Eukaryota  185/199 : Viruses  0/175   --->[See Alignment]
a.100.1c.143.1c.2.1
:338 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   3->319 1z82A PDBj 6e-54 45.4 %
:RPS:PDB   4->337 1dliA PDBj 3e-33 15.7 %
:RPS:SCOP  11->202 2hzbA1  c.143.1.1 * 5e-21 10.9 %
:RPS:SCOP  185->329 1txgA1  a.100.1.6 * 7e-53 36.4 %
:HMM:SCOP  3->184 1txgA2 c.2.1.6 * 1.5e-57 47.2 %
:HMM:SCOP  184->336 1evyA1 a.100.1.6 * 4.5e-59 56.9 %
:RPS:PFM   4->159 PF01210 * NAD_Gly3P_dh_N 2e-27 45.3 %
:RPS:PFM   185->328 PF07479 * NAD_Gly3P_dh_C 6e-46 59.7 %
:HMM:PFM   4->166 PF01210 * NAD_Gly3P_dh_N 9.7e-55 46.5 157/159  
:HMM:PFM   184->325 PF07479 * NAD_Gly3P_dh_C 8e-54 49.3 142/149  
:BLT:SWISS 1->338 GPDA_LACS1 0.0 100.0 %
:PROS 193->214|PS00957|NAD_G3PDH
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABD99185.1 GT:GENE gpsA GT:PRODUCT Glycerol-3-phosphate dehydrogenase (NAD(P)+) GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION 402745..403761 GB:FROM 402745 GB:TO 403761 GB:DIRECTION + GB:GENE gpsA GB:PRODUCT Glycerol-3-phosphate dehydrogenase (NAD(P)+) GB:NOTE COG0240 [C] Glycerol-3-phosphate dehydrogenase GB:PROTEIN_ID ABD99185.1 GB:DB_XREF GI:90820546 GB:GENE:GENE gpsA LENGTH 338 SQ:AASEQ MTEKIAVLGAGSWGSILAGVLDENKNEVWLWTNKESQAKELNENHTNEHYIPGHKYSETIKATTNLKEAVDGASAVLFVVPTKVIRLVAQQLVEVLKELGQKPLIIHASKGLELGSHKRISEVIEEEIPSEYRKDVVVLSGPSHAEEVARKDITLITAACENLDSAKKVQSLFMNDYLRIYTNKDVIGVETGAAFKNVIAIGVGALHGLGYGDDAKAALMTRGLAEISRLGVAFGADPLTFIGLSGVGDLIVTCTSVHSRNWRAGNQLGKGKALDEVIQDMGMVIEGINTCKAAYELAQQKNIEMPITEAIYNVLYNGKDIKDEISLLMQREGKEEIK GT:EXON 1|1-338:0| SW:ID GPDA_LACS1 SW:DE RecName: Full=Glycerol-3-phosphate dehydrogenase [NAD(P)+]; EC=1.1.1.94;AltName: Full=NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; SW:GN Name=gpsA; OrderedLocusNames=LSL_0372; SW:KW Complete proteome; Cytoplasm; NAD; Oxidoreductase;Phospholipid biosynthesis. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->338|GPDA_LACS1|0.0|100.0|338/338| GO:SWS:NREP 4 GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0016491|"GO:oxidoreductase activity"|Oxidoreductase| GO:SWS GO:0055114|"GO:oxidation reduction"|Oxidoreductase| GO:SWS GO:0008654|"GO:phospholipid biosynthetic process"|Phospholipid biosynthesis| PROS 193->214|PS00957|NAD_G3PDH|PDOC00740| SEG 120->131|isevieeeipse| BL:PDB:NREP 1 BL:PDB:REP 3->319|1z82A|6e-54|45.4|293/302| RP:PDB:NREP 1 RP:PDB:REP 4->337|1dliA|3e-33|15.7|313/402| RP:PFM:NREP 2 RP:PFM:REP 4->159|PF01210|2e-27|45.3|150/159|NAD_Gly3P_dh_N| RP:PFM:REP 185->328|PF07479|6e-46|59.7|144/145|NAD_Gly3P_dh_C| HM:PFM:NREP 2 HM:PFM:REP 4->166|PF01210|9.7e-55|46.5|157/159|NAD_Gly3P_dh_N| HM:PFM:REP 184->325|PF07479|8e-54|49.3|142/149|NAD_Gly3P_dh_C| GO:PFM:NREP 8 GO:PFM GO:0005737|"GO:cytoplasm"|PF01210|IPR011128| GO:PFM GO:0016616|"GO:oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor"|PF01210|IPR011128| GO:PFM GO:0046168|"GO:glycerol-3-phosphate catabolic process"|PF01210|IPR011128| GO:PFM GO:0051287|"GO:NAD or NADH binding"|PF01210|IPR011128| GO:PFM GO:0055114|"GO:oxidation reduction"|PF01210|IPR011128| GO:PFM GO:0005975|"GO:carbohydrate metabolic process"|PF07479|IPR006109| GO:PFM GO:0016614|"GO:oxidoreductase activity, acting on CH-OH group of donors"|PF07479|IPR006109| GO:PFM GO:0055114|"GO:oxidation reduction"|PF07479|IPR006109| RP:SCP:NREP 2 RP:SCP:REP 11->202|2hzbA1|5e-21|10.9|183/311|c.143.1.1| RP:SCP:REP 185->329|1txgA1|7e-53|36.4|143/155|a.100.1.6| HM:SCP:REP 3->184|1txgA2|1.5e-57|47.2|176/0|c.2.1.6|1/1|NAD(P)-binding Rossmann-fold domains| HM:SCP:REP 184->336|1evyA1|4.5e-59|56.9|153/160|a.100.1.6|1/1|6-phosphogluconate dehydrogenase C-terminal domain-like| OP:NHOMO 1268 OP:NHOMOORG 1048 OP:PATTERN -----------------------1--------1-1-----------1--------------------- 111-111111121121222-221122222222222212221111-1211111111111111111111111111111111111-11111111111111--1111111112111111111111111111111111111-----1111-11111111111-----111111111------------11111111111111111111111111111111111111111111111111111111111111111121111112112111111111111111111111111111111111111111111111211111111111111111-111211111111111111-11121111111111111111111111--1111-111111111111111111111111111111111-11111111111111111111112111111211111111111111111111111111111111111111111-111-1111111111112111111111111111111111111111111111111111111111111111111111111111111111111-111111111111-1111111111111112111111111111111111111111111111111111111111111111111111111111-11211------11111111111111111-111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-1111111111111111111111111111111111111111111111111111111111111111111111111113333331111111111111111-111-11----111-111111111111-11111 1211----411-22111111222222211111111111-1-111111111111111111111122111-22221222-2212222222-111112132212-13351231235334421112213412-2A21222-22122222-22112111224341313121142413531253172223362231322243322 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 338 STR:RPRED 100.0 SQ:SECSTR ccEEEEEEcccHHHHHHHHHHHTTTcEEEEEcccHHHHHHHHTTccccccHHHHHHHHHcccEccHHHHHHHccEEEEcccccETTTTEEccHHHHHHHHHHHHHHHHccccEEcccTTHHHHHHHHHTcccEEEccccccTTcTTHHHHccccEEEEccTTcTccHHHHHHHHHHHHHHHHHHHHHHHHcccccccEEEEcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTccHHHHHHHHHTcTTTcccHHHccccccccccccccHHHHHHHHHHHHHTTTccccHHHHHHHHHHHHHHHHHHHHHHHHHHTccccccEEEEEcccccTTcc DISOP:02AL 1-1,330-331,333-339| PSIPRED cccEEEEEcccHHHHHHHHHHHHcccEEEEEEccHHHHHHHHHccccccccccccccccEEEEccHHHHHccccEEEEEccHHHHHHHHHHHHHHHHHcccccEEEEEEccccccccHHHHHHHHHHccHHccccEEEEEccHHHHHHHcccccEEEEEcccHHHHHHHHHHHccccEEEEEEccHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHccccHHHHHHHHcccccHHHHHHHHHHHHHHcccccHHHHHHHHHHHccccHHHHHHHHHccccccccc //