[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : guaA.1
DDBJ      :guaA         GMP synthase
Swiss-Prot:             

Homologs  Archaea  18/68 : Bacteria  276/915 : Eukaryota  8/199 : Viruses  0/175   --->[See Alignment]
c.23.16
:221 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   39->171 1o1yA PDBj 7e-18 40.0 %
:RPS:PDB   53->171 2a9vB PDBj 8e-14 26.3 %
:RPS:SCOP  27->183 2ghrA1  c.23.16.8 * 1e-18 21.0 %
:HMM:SCOP  13->210 2ghrA1 c.23.16.8 * 9.3e-31 28.7 %
:RPS:PFM   43->170 PF00117 * GATase 7e-04 32.2 %
:HMM:PFM   23->172 PF00117 * GATase 8.5e-18 27.1 144/192  
:BLT:SWISS 1->217 YFEJ_SALTY 5e-17 28.7 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABD98987.1 GT:GENE guaA.1 GT:PRODUCT GMP synthase GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION 199067..199732 GB:FROM 199067 GB:TO 199732 GB:DIRECTION + GB:GENE guaA GB:PRODUCT GMP synthase GB:NOTE COG0518 [F] GMP synthase - Glutamine amidotransferase domain glutamine-hydrolyzing GB:PROTEIN_ID ABD98987.1 GB:DB_XREF GI:90820348 GB:GENE:GENE guaA LENGTH 221 SQ:AASEQ MKMNVLQHSIHEGIGLIGEWAENNGYEVNVYQAANNNVKLPEVIDTDMLVVLGGPMSVNDDEEWIVKERELIRGMLMAHKSYLGICFGAQQLSKTLGGDVSSCPKEVGWGEVKRLSNIIPEVPEKLDVLHWHGEQFRLPTEATPLFSSPLVENQGFIINENAIGLQFHLEMNEAGVREVVENDSEFIKGNKLKQSAADILKHKVPEMNKQALFAMLDYIKD GT:EXON 1|1-221:0| BL:SWS:NREP 1 BL:SWS:REP 1->217|YFEJ_SALTY|5e-17|28.7|216/239| BL:PDB:NREP 1 BL:PDB:REP 39->171|1o1yA|7e-18|40.0|130/223| RP:PDB:NREP 1 RP:PDB:REP 53->171|2a9vB|8e-14|26.3|114/195| RP:PFM:NREP 1 RP:PFM:REP 43->170|PF00117|7e-04|32.2|121/185|GATase| HM:PFM:NREP 1 HM:PFM:REP 23->172|PF00117|8.5e-18|27.1|144/192|GATase| GO:PFM:NREP 1 GO:PFM GO:0003824|"GO:catalytic activity"|PF00117|IPR000991| RP:SCP:NREP 1 RP:SCP:REP 27->183|2ghrA1|1e-18|21.0|157/269|c.23.16.8| HM:SCP:REP 13->210|2ghrA1|9.3e-31|28.7|195/0|c.23.16.8|1/1|Class I glutamine amidotransferase-like| OP:NHOMO 354 OP:NHOMOORG 302 OP:PATTERN ------111111111--------1-------------------22--1--323-------------11 --1------------------1---1------1-----1-1-------1---1----1--1111--1-1--1111111----1-1111-----------------111-----------------11-1-111111-----------------1-11--11---11-----1111-1111111------------------------------------------111111-1----1----------------1111111111111122-2--------------111---------------------------1-------1---------------11----------------2-1-----11----1-1-----1111122111--132--2----------1---2--1--132-22212212221112---------1----------------1-1-----------------------------1-12-1-----1111111111111111111111111111--1111----2-1----1-12121--------111-111-1------1-----1112-1--1----1--21------------------------11--1-1-1------111--11--1---1-11---1---------1----1-------------------------------111-1---11111111111111111-------------------------111111211-1-1----------------2222222---112222-1-----------11---11-111-------------11----------------111111-----------------------------------------1-111--1 ---------------------------------------------------------1----1-----------------------------------------------------------------------------------------------------------2--------------122--11------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 206 STR:RPRED 93.2 SQ:SECSTR GccEEEEEEEccccHHHHHHHHTTTEEEEEEETTTccHHHHHTTcccEEEEccccGGGTGGGHHHHHHTHHHHHHHHccccEEEETHHHHHHHHHTTcEEEEEEEEEEEEEEEEccGGGTTcccEEEEEEEEEEEEcccTTEEEEEEcccccccEEEEcccEEEEcccTTcTTcTTHHHHHHHHHHHHHHHHHHETTccEEEEccc############### PSIPRED cEEEEEEccccccccHHHHHHHHcccEEEEEEcccccccccccccccEEEEccccccccccHHHHHHHHHHHHHHHHccccEEEEcHHHHHHHHHHccEEEEccccccccccEEcccccccccccEEEEEEcccEEEcccccEEEEEcccccEEEEEEcccEEEEEEcccccHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHcc //